Acyl-CoA-binding protein (DBI) Recombinant Protein | DBI recombinant protein
Recombinant Dog Acyl-CoA-binding protein (DBI)
Gene Names
DBI; EP; ACBP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-CoA-binding protein (DBI); Recombinant Dog Acyl-CoA-binding protein (DBI); DBI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-87, Full length protein
Sequence
SQAEFDKAAEDVKHLKTKPADDEMLYIYSHYKQATVGDINTERPGLLDLRGKAKWDAWNQLKGTSKEDAMKAYVNKVEDLKKKYGI
Sequence Length
86
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DBI recombinant protein
This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,978 Da
NCBI Official Full Name
acyl-CoA-binding protein
NCBI Official Synonym Full Names
diazepam binding inhibitor, acyl-CoA binding protein
NCBI Official Symbol
DBI
NCBI Official Synonym Symbols
EP; ACBP
NCBI Protein Information
acyl-CoA-binding protein
UniProt Protein Name
Acyl-CoA-binding protein
Protein Family
UniProt Gene Name
DBI
UniProt Synonym Gene Names
ACBP; DBI; EP
Uniprot Description
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Similar Products
Product Notes
The DBI dbi (Catalog #AAA1433795) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-87, Full length protein. The amino acid sequence is listed below: SQAEFDKAAE DVKHLKTKPA DDEMLYIYSH YKQATVGDIN TERPGLLDLR GKAKWDAWNQ LKGTSKEDAM KAYVNKVEDL KKKYGI. It is sometimes possible for the material contained within the vial of "Acyl-CoA-binding protein (DBI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
