Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cyclin-dependent kinase inhibitor 1 (KRP1) Recombinant Protein | KRP1 recombinant protein

Recombinant Arabidopsis thaliana Cyclin-dependent kinase inhibitor 1 (KRP1)

Gene Names
ICK1; CYCLIN-DEPENDENT KINASE INHIBITOR PROTEIN; F26B6.8; F26B6_8; KIP-RELATED PROTEIN 1; KRP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase inhibitor 1 (KRP1); Recombinant Arabidopsis thaliana Cyclin-dependent kinase inhibitor 1 (KRP1); KRP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-191, Full length protein
Sequence
MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE
Sequence Length
191
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,283 Da
NCBI Official Full Name
Cyclin-dependent kinase inhibitor family protein
NCBI Official Symbol
ICK1
NCBI Official Synonym Symbols
CYCLIN-DEPENDENT KINASE INHIBITOR PROTEIN; F26B6.8; F26B6_8; KIP-RELATED PROTEIN 1; KRP1
NCBI Protein Information
Cyclin-dependent kinase inhibitor family protein
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1
UniProt Gene Name
KRP1
UniProt Synonym Gene Names
ICK1

NCBI Description

Encodes a cyclin-dependent kinase inhibitor protein that functions as a negative regulator of cell division and promoter of endoreduplication. A member of seven KRP genes found in Arabidopsis thaliana. Differential expression patterns for distinct KRPs were revealed by in situ hybridization. Both SKP2b and RKP appear to be involved in the degradation of KRP1.

Uniprot Description

Binds and inhibits CYCD2-1/CDKA-1 kinase complex activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. Functions in turning cells from a mitotic to an endoreplicating cell cycle mode. Acts cell- and non-cell-autonomously to regulate endoreduplication by allowing S phase progression, but blocking entry into mitosis. Keeps on the one hand the plant cell cycle locally controlled, and on the other hand provides a possibility of linking cell cycle control in single cells with the supracellular organization of a tissue or an organ. May target specifically CDKA-1.

Research Articles on KRP1

Similar Products

Product Notes

The KRP1 krp1 (Catalog #AAA1432892) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-191, Full length protein. The amino acid sequence is listed below: MVRKYRKAKG IVEAGVSSTY MQLRSRRIVY VRSEKSSSVS VVGDNGVSSS CSGSNEYKKK ELIHLEEEDK DGDTETSTYR RGTKRKLFEN LREEEKEELS KSMENYSSEF ESAVKESLDC CCSGRKTMEE TVTAEEEEKA KLMTEMPTES EIEDFFVEAE KQLKEKFKKK YNFDFEKEKP LEGRYEWVKL E. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase inhibitor 1 (KRP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.