Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Endothelial cell-specific molecule 1 Recombinant Protein | Esm1 recombinant protein

Recombinant Mouse Endothelial cell-specific molecule 1

Gene Names
Esm1; ESM-1; AV004503; 0610042H23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endothelial cell-specific molecule 1; Recombinant Mouse Endothelial cell-specific molecule 1; ESM-1; Esm1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-184aa; Full Length
Sequence
AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR
Sequence Length
184
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Esm1 recombinant protein
Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions
Product Categories/Family for Esm1 recombinant protein
References
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.7 kDa
NCBI Official Full Name
endothelial cell-specific molecule 1
NCBI Official Synonym Full Names
endothelial cell-specific molecule 1
NCBI Official Symbol
Esm1
NCBI Official Synonym Symbols
ESM-1; AV004503; 0610042H23Rik
NCBI Protein Information
endothelial cell-specific molecule 1
UniProt Protein Name
Endothelial cell-specific molecule 1
UniProt Gene Name
Esm1
UniProt Synonym Gene Names
ESM-1
UniProt Entry Name
ESM1_MOUSE

Uniprot Description

ESM1: May have potent implications in lung endothelial cell- leukocyte interactions. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular region

Molecular Function: hepatocyte growth factor receptor binding; insulin-like growth factor binding; integrin binding

Biological Process: angiogenesis; positive regulation of cell proliferation; regulation of cell growth; sprouting angiogenesis

Research Articles on Esm1

Similar Products

Product Notes

The Esm1 esm1 (Catalog #AAA1431009) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-184aa; Full Length. The amino acid sequence is listed below: AKYAVDCPEH CDKTECRSSL RCKRTVLDDC GCCQVCAAGP GETCYRTVSG MDGVKCGPGL KCHFYSEEDD FGDEFGICKD CPYGTFGMEC KETCNCQSGI CDRVTGRCLD FPFFQYAAAK SPSRTSASHT ERDSASGDGN AVREEIGEGN AARPSVMKWL NPR. It is sometimes possible for the material contained within the vial of "Endothelial cell-specific molecule 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.