BAG family molecular chaperone regulator 4 (Bag4) Recombinant Protein | Bag4 recombinant protein
Recombinant Mouse BAG family molecular chaperone regulator 4 (Bag4)
Gene Names
Bag4; SODD; 2410112I15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BAG family molecular chaperone regulator 4 (Bag4); Recombinant Mouse BAG family molecular chaperone regulator 4 (Bag4); Bag4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-457, full length protein
Sequence
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHVPPPLYPPLRPEPPQPPVSWRGRGGAPAETTWPGEGAGGDGYYPSGGAWAEASRAGGGHQEQPPYPGYNSNYWNSVRPRAPYPGSYSVRPELQGQSLNSYANGAYGPPYPPGPGASTASYSGAYYVPGYTQSNYSTEVPNTYRSPGNSPTPMSRWMYSQQDCPTEAPPLRGQVPGYPASQNPGMTLPHYPYGDGNRAVPQSGGTGRPQDDAWASSAYGMGARYPWPSAAPSAPSAGSLYMTESASPWPGNSSPQPPPSPPPQQPKDPSYSYNPSGQGLSRHSFPCSVHQYESPGAVNNDNSDLLDSQVQYSAEPQLYGNASSEHPSNQVPSNNLPEECFSSDEGTPPSIKKIIHVLEKVQFLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL
Sequence Length
457
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Bag4 recombinant protein
This protein is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70
Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost.
Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,095 Da
NCBI Official Full Name
BAG family molecular chaperone regulator 4
NCBI Official Synonym Full Names
BCL2-associated athanogene 4
NCBI Official Symbol
Bag4
NCBI Official Synonym Symbols
SODD; 2410112I15Rik
NCBI Protein Information
BAG family molecular chaperone regulator 4
UniProt Protein Name
BAG family molecular chaperone regulator 4
Protein Family
UniProt Gene Name
Bag4
UniProt Synonym Gene Names
Sodd; BAG-4
Uniprot Description
Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. Prevents constitutive TNFRSF1A signaling (). Negative regulator of PRKN translocation to damaged mitochondria ().
Research Articles on Bag4
Similar Products
Product Notes
The Bag4 bag4 (Catalog #AAA1426027) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-457, full length protein. The amino acid sequence is listed below: MSALRRSGYG PSDGPSYGRY YGPGGGDVPV HVPPPLYPPL RPEPPQPPVS WRGRGGAPAE TTWPGEGAGG DGYYPSGGAW AEASRAGGGH QEQPPYPGYN SNYWNSVRPR APYPGSYSVR PELQGQSLNS YANGAYGPPY PPGPGASTAS YSGAYYVPGY TQSNYSTEVP NTYRSPGNSP TPMSRWMYSQ QDCPTEAPPL RGQVPGYPAS QNPGMTLPHY PYGDGNRAVP QSGGTGRPQD DAWASSAYGM GARYPWPSAA PSAPSAGSLY MTESASPWPG NSSPQPPPSP PPQQPKDPSY SYNPSGQGLS RHSFPCSVHQ YESPGAVNND NSDLLDSQVQ YSAEPQLYGN ASSEHPSNQV PSNNLPEECF SSDEGTPPSI KKIIHVLEKV QFLEQEVEEF VGKKTDKAYW LLEEMLTKEL LELDSVETGG QDSVRQARKE AVCKIQAILE KLEKKGL. It is sometimes possible for the material contained within the vial of "BAG family molecular chaperone regulator 4 (Bag4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
