CREB-regulated transcription coactivator 3 (CRTC3) Recombinant Protein | CRTC3 recombinant protein

Recombinant Human CREB-regulated transcription coactivator 3 (CRTC3)

Cat. Num. AAA1425776

• Gene Names: CRTC3; TORC3; TORC-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CREB-regulated transcription coactivator 3 (CRTC3); Recombinant Human CREB-regulated transcription coactivator 3 (CRTC3); CRTC3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-619, Full length protein
• Sequence: MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL
• Sequence Length: 619

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 110431352
• NCBI GeneID: 64784
• NCBI Accession #: NP_001036039.1
• NCBI GenBank Nucleotide #: NM_001042574.2
• UniProt Accession #: Q6UUV7; Q6DK61; Q6DK62; Q8NF38; Q9H6U2
• Molecular Weight: 66,830 Da
• NCBI Official Full Name: CREB-regulated transcription coactivator 3 isoform b
• NCBI Official Synonym Full Names: CREB regulated transcription coactivator 3
• NCBI Official Symbol: CRTC3
• NCBI Official Synonym Symbols: TORC3; TORC-3
• NCBI Protein Information: CREB-regulated transcription coactivator 3
• UniProt Protein Name: CREB-regulated transcription coactivator 3
• Protein Family: CREB-regulated transcription coactivator
• UniProt Gene Name: CRTC3
• UniProt Synonym Gene Names: TORC3; TORC-3; Transducer of CREB protein 3

NCBI Description

This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).