Pro-Nerve Growth Factor Recombinant Protein | ProNGF recombinant protein

Recombinant Human Pro-Nerve Growth Factor

Cat. Num. AAA142302

• Gene Names: NGF; NGFB; HSAN5; Beta-NGF
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Synonyms: Pro-Nerve Growth Factor; Recombinant Human Pro-Nerve Growth Factor; ProNGF Human; Pro-Nerve Growth Factor Human Recombinant; Human Pro-NGF; ProNGF; NGFB; ProNGF recombinant protein

• Host: E Coli
• Purity/Purification: Greater than 95.0% as determined by SDS-PAGE.
• Form/Format: ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
• Sequence Length: 241

• Solubility: It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Preparation and Storage: Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution ProNGF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. Please prevent freeze-thaw cycles.

Related Product Information for ProNGF recombinant protein

Description: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

Product Categories/Family for ProNGF recombinant protein

Cytokines and Growth Factors; Neurotrophins; Beta-Nerve Growth Factor

NCBI and Uniprot Product Information

• NCBI GI #: 70995319
• NCBI GeneID: 4803
• NCBI Accession #: NP_002497.2
• NCBI GenBank Nucleotide #: NM_002506.2
• UniProt Accession #: P01138; Q6FHA0; Q96P60; Q9P2Q8; Q9UKL8; A1A4E5
• NCBI Official Full Name: beta-nerve growth factor
• NCBI Official Synonym Full Names: nerve growth factor (beta polypeptide)
• NCBI Official Symbol: NGF
• NCBI Official Synonym Symbols: NGFB; HSAN5; Beta-NGF
• NCBI Protein Information: beta-nerve growth factor; nerve growth factor, beta subunit
• UniProt Protein Name: Beta-nerve growth factor
• UniProt Gene Name: NGF
• UniProt Synonym Gene Names: NGFB; Beta-NGF
• UniProt Entry Name: NGF_HUMAN

NCBI Description

This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]

Uniprot Description

NGF: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Homodimer. Belongs to the NGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: extracellular space; Golgi lumen; cytoplasmic membrane-bound vesicle; extracellular region; endosome

Molecular Function: metalloendopeptidase inhibitor activity; protein binding; nerve growth factor receptor binding; growth factor activity; receptor signaling protein activity

Biological Process: response to nicotine; circadian rhythm; response to peptide hormone stimulus; activation of MAPKK activity; nerve growth factor receptor signaling pathway; adult locomotory behavior; positive regulation of apoptosis; regulation of neuron differentiation; positive regulation of axon extension; response to glucocorticoid stimulus; regulation of neurotransmitter secretion; response to lipopolysaccharide; regulation of axonogenesis; regulation of caspase activity; sensory perception of pain; negative regulation of cell cycle; nerve growth factor processing; response to radiation; cell-cell signaling; small GTPase mediated signal transduction; negative regulation of neuron apoptosis; response to electrical stimulus; inflammatory response; response to drug; positive regulation of neuron maturation; phosphoinositide-mediated signaling; positive regulation of protein amino acid autophosphorylation; positive regulation of nerve growth factor receptor signaling pathway; regulation of release of sequestered calcium ion into cytosol; memory; peripheral nervous system development; neuron apoptosis; induction of apoptosis via death domain receptors; response to mechanical stimulus; phospholipase C activation; response to ozone; Ras protein signal transduction; positive regulation of transcription factor activity; positive regulation of axonogenesis; neurite morphogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type V