Interleukin-1 beta Active Protein | rIL 1 beta active protein

Recombinant Rat Interleukin-1 beta

Cat. Num. AAA142270

• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Synonyms: Interleukin-1 beta; Recombinant Rat Interleukin-1 beta; IL 1 beta Rat; Interleukin-1 beta Rat Recombinant; Catabolin; Lymphocyte-activating factor (LAF); Endogenous Pyrogen (EP); Leukocyte Endogenous Mediator (LEM); Mononuclear Cell Factor (MCF); IL1F2; IL-1 beta; rIL 1 beta active protein

• Host: E Coli
• Purity/Purification: Greater than 97.0% as determined by SDS-PAGE.
• Form/Format: The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
• Sequence Length: 268

• Solubility: It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Protein Content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
• Biological Activity: The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
• Preparation and Storage: Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL1b should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for rIL 1 beta active protein

Introduction: Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Product Categories/Family for rIL 1 beta active protein

Cytokines and Growth Factors; Cytokines; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 2497335
• NCBI GeneID: 24494
• UniProt Accession #: Q63264
• Molecular Weight: 30,644 Da
• NCBI Official Full Name: Interleukin-1 beta
• NCBI Official Synonym Full Names: interleukin 1 beta
• NCBI Official Symbol: Il1b
• NCBI Protein Information: interleukin-1 beta; IL-1 beta
• UniProt Protein Name: Interleukin-1 beta
• Protein Family: Interleukin
• UniProt Gene Name: Il1b
• UniProt Synonym Gene Names: IL-1 beta
• UniProt Entry Name: IL1B_RAT

NCBI Description

an inflammatory cytokine [RGD, Feb 2006]

Uniprot Description

IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family.

Protein type: Cytokine

Cellular Component: extracellular space; extracellular region; vesicle; secretory granule

Molecular Function: protein domain specific binding; interleukin-1 receptor binding; cytokine activity

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of JNK activity; negative regulation of MAP kinase activity; positive regulation of nitric oxide biosynthetic process; negative regulation of glutamate secretion; glycoprotein metabolic process; positive regulation of apoptosis; activation of MAPK activity; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; germ cell programmed cell death; response to glucocorticoid stimulus; negative regulation of insulin receptor signaling pathway; positive regulation of NF-kappaB import into nucleus; positive regulation of glial cell differentiation; positive regulation of lipid catabolic process; response to lipopolysaccharide; fever; response to organic cyclic substance; positive regulation of membrane protein ectodomain proteolysis; response to carbohydrate stimulus; activation of NF-kappaB transcription factor; elevation of cytosolic calcium ion concentration; response to vitamin D; pentacyclic triterpenoid metabolic process; positive regulation of phagocytosis; positive regulation of T cell proliferation; positive regulation of astrocyte differentiation; response to drug; neutrophil chemotaxis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of heterotypic cell-cell adhesion; positive regulation of mitosis; interleukin-1 beta production; positive regulation of interleukin-6 production; social behavior; response to organic nitrogen; purine base metabolic process; negative regulation of neuron differentiation; positive regulation of angiogenesis; response to ethanol; response to heat; positive regulation of cell division; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; negative regulation of lipid metabolic process; leukocyte migration; response to peptide hormone stimulus; estrogen metabolic process; sequestering of triacylglycerol; wound healing; positive regulation of interleukin-6 biosynthetic process; response to morphine; positive regulation of JNK cascade; negative regulation of transcription from RNA polymerase II promoter; response to L-ascorbic acid; chronic inflammatory response to antigenic stimulus; response to estradiol stimulus; positive regulation of stress-activated MAPK cascade; negative regulation of neurogenesis; positive regulation of interleukin-8 production; negative regulation of cell proliferation; learning and/or memory; negative regulation of lipid catabolic process; hyaluronan biosynthetic process; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; response to gamma radiation; inflammatory response; regulation of I-kappaB kinase/NF-kappaB cascade; response to nutrient; aging; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; positive regulation of immature T cell proliferation in the thymus; memory; response to ATP; ovulation; polyketide metabolic process; positive regulation of interferon-gamma production; positive regulation of chemokine biosynthetic process; response to ozone; positive regulation of prostaglandin secretion; response to hypoxia; positive regulation of fever; immune response; positive regulation of protein amino acid phosphorylation; regulation of insulin secretion