E3 ubiquitin-protein ligase RING2-A (rnf2-a) Recombinant Protein | rnf2-a recombinant protein
Recombinant Xenopus laevis E3 ubiquitin-protein ligase RING2-A (rnf2-a)
Gene Names
ring1.S; bap1; ding; rnf1; bap-1; hipi3; ring2; ring1a; ring1b; rnf2-a; ring1-a; ring1-b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RING2-A (rnf2-a); Recombinant Xenopus laevis E3 ubiquitin-protein ligase RING2-A (rnf2-a); rnf2-a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-344, Full length protein
Sequence
MATPVNAQCSSKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAKLNRLHNQQALSSSIEEGLKMQAMHRAQRVRKHQHESDNTTFSGGEDNCDSRSHVSNPSVHSNQEAGPSRKRSRASEDSGAEPDLSHEGGVRSPDPPGGGETGSEIELVFRAHPLLVEKDGYSQTRYVKTTANATVDHLSKYLALRIALEEEVLRGEAEGVTLGEVSEKQYTIYICTGVAGGQYTTLNGSLTLELVNEKYWKVSKPLELYYAPTKEQK
Sequence Length
344
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,366 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RING2-A
NCBI Official Synonym Full Names
ring finger protein 1 S homeolog
NCBI Official Symbol
ring1.S
NCBI Official Synonym Symbols
bap1; ding; rnf1; bap-1; hipi3; ring2; ring1a; ring1b; rnf2-a; ring1-a; ring1-b
NCBI Protein Information
E3 ubiquitin-protein ligase RING2-A
UniProt Protein Name
E3 ubiquitin-protein ligase RING2-A
Protein Family
UniProt Gene Name
rnf2-a
UniProt Synonym Gene Names
ring1b-a; RING1b-A
Uniprot Description
E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation. H2AK119Ub gives a specific tag for epigenetic transcriptional repression. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.
Similar Products
Product Notes
The rnf2-a rnf2-a (Catalog #AAA1421614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344, Full length protein. The amino acid sequence is listed below: MATPVNAQCS SKTWELSLYE LHRTPQEAIM DGTEIAVSPR SLHSELMCPI CLDMLKNTMT TKECLHRFCS DCIVTALRSG NKECPTCRKK LVSKRSLRPD PNFDALISKI YPSRDEYEAH QDRVLAKLNR LHNQQALSSS IEEGLKMQAM HRAQRVRKHQ HESDNTTFSG GEDNCDSRSH VSNPSVHSNQ EAGPSRKRSR ASEDSGAEPD LSHEGGVRSP DPPGGGETGS EIELVFRAHP LLVEKDGYSQ TRYVKTTANA TVDHLSKYLA LRIALEEEVL RGEAEGVTLG EVSEKQYTIY ICTGVAGGQY TTLNGSLTLE LVNEKYWKVS KPLELYYAPT KEQK. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RING2-A (rnf2-a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
