Uncharacterized protein C9orf114 (C9orf114) Recombinant Protein | C9orf114 recombinant protein
Recombinant Human Uncharacterized protein C9orf114 (C9orf114)
Gene Names
SPOUT1; CENP32; CENP-32; HSPC109; C9orf114
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein C9orf114 (C9orf114); Recombinant Human Uncharacterized protein C9orf114 (C9orf114); C9orf114 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-376, Full length protein
Sequence
MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT
Sequence Length
376
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,009 Da
NCBI Official Full Name
putative methyltransferase C9orf114
NCBI Official Synonym Full Names
SPOUT domain containing methyltransferase 1
NCBI Official Symbol
SPOUT1
NCBI Official Synonym Symbols
CENP32; CENP-32; HSPC109; C9orf114
NCBI Protein Information
putative methyltransferase C9orf114
UniProt Protein Name
Putative methyltransferase C9orf114
Protein Family
UniProt Gene Name
SPOUT1
UniProt Synonym Gene Names
CENP-32
Uniprot Description
Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase (PubMed:20813266, PubMed:25657325). Also involved in chromosome alignment (PubMed:20813266). May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis (PubMed:25657325). Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (PubMed:28431233).
Research Articles on C9orf114
Similar Products
Product Notes
The C9orf114 spout1 (Catalog #AAA1420559) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-376, Full length protein. The amino acid sequence is listed below: MAERGRKRPC GPGEHGQRIE WRKWKQQKKE EKKKWKDLKL MKKLERQRAQ EEQAKRLEEE EAAAEKEDRG RPYTLSVALP GSILDNAQSP ELRTYLAGQI ARACAIFCVD EIVVFDEEGQ DAKTVEGEFT GVGKKGQACV QLARILQYLE CPQYLRKAFF PKHQDLQFAG LLNPLDSPHH MRQDEESEFR EGIVVDRPTR PGHGSFVNCG MKKEVKIDKN LEPGLRVTVR LNQQQHPDCK TYHGKVVSSQ DPRTKAGLYW GYTVRLASCL SAVFAEAPFQ DGYDLTIGTS ERGSDVASAQ LPNFRHALVV FGGLQGLEAG ADADPNLEVA EPSVLFDLYV NTCPGQGSRT IRTEEAILIS LAALQPGLIQ AGARHT. It is sometimes possible for the material contained within the vial of "Uncharacterized protein C9orf114 (C9orf114), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
