Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

I-TAC Active Protein | I TAC active protein

Recombinant Human I-TAC (CXCL11)

Gene Names
CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
I-TAC; Recombinant Human I-TAC (CXCL11); I TAC Human; I-TAC Human Recombinant (CXCL11); Small inducible cytokine B11; CXCL11; Interferon-inducible T-cell alpha chemoattractant; Interferon-gamma-inducible protein 9; IP-9; H174; Beta-R1; chemokine (C-X-C motif) ligand 11; IP9; b-R1; SCYB11; SCYB9B; MGC102770; I TAC active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Sequence Length
106
Solubility
It is recommended to reconstitute the lyophilized I-TAC in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.
Preparation and Storage
Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution I-TAC should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for I TAC active protein
Description: I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton. The I-TAC is purified by proprietary chromatographic techniques.

Introduction: Chemokine (C-X-C motif) ligand 11 (CXCL11) is a small cytokine belonging to the CXC chemokinen family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9). I-TAC is highly expressed in peripheral blood leukocytes, pancreas and liver, with moderate levels in thymus, spleen and lung and low expression levels were in small intestine, placenta and prostate. Gene expression of CXCL11 is strongly induced by IFN-g and IFN-b, and weakly induced by IFN-a. The I-TAC chemokine elicits its effects on its target cells by interacting with the cell surface chemokine receptor CXCR3, with a higher affinity than do the other ligands for this receptor, CXCL9 and CXCL10. I-TAC is chemotactic for activated T cells. The CXCL11 gene is located on human chromosome 4 along with many other members of the CXC chemokine family.
Product Categories/Family for I TAC active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,365 Da
NCBI Official Full Name
C-X-C motif chemokine 11 isoform 2
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
CXCL11
NCBI Official Synonym Symbols
IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
NCBI Protein Information
C-X-C motif chemokine 11; beta-R1; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine B11; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; small-inducible cytokine B11
UniProt Protein Name
C-X-C motif chemokine 11
UniProt Gene Name
CXCL11
UniProt Synonym Gene Names
ITAC; SCYB11; SCYB9B; IP-9; I-TAC
UniProt Entry Name
CXL11_HUMAN

NCBI Description

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

CXCL11: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis; Chemokine

Chromosomal Location of Human Ortholog: 4q21.2

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; response to lipopolysaccharide; immune response; positive regulation of leukocyte chemotaxis; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cAMP metabolic process; signal transduction; inflammatory response; chemotaxis; regulation of cell proliferation

Research Articles on I TAC

Similar Products

Product Notes

The I TAC cxcl11 (Catalog #AAA142041) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FPMFKRGRCL CIGPGVKAVK VADIEKASIM YPSNNCDKIE VIITLKENKG QRCLNPKSKQ ARLIIKKVER KNF. It is sometimes possible for the material contained within the vial of "I-TAC, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.