Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cysteine protease ATG4B (ATG4B) Recombinant Protein | ATG4B recombinant protein

Recombinant Chicken Cysteine protease ATG4B (ATG4B)

Gene Names
ATG4B; APG4B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine protease ATG4B (ATG4B); Recombinant Chicken Cysteine protease ATG4B (ATG4B); ATG4B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393, Full length protein
Sequence
MDAATLTYDTLRFEYEDFPETKEPVWILGRKYSVFTEKEEILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWIKGKRQTDNYFSVLNAFIDKKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLATFDTWSSLAVHIAMDNTVVMEEIRRLCQSNFSCAGAAACPAVEADVLYNGYPEEAGVRDKLSLWKPLVLLIPLRLGLTEINEAYIETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPSDSGCLPDESFHCQHPPCRMSIAELDPSIAVGFFCHTEEDFNDWCHQIKKLSLVRGALPMFELVERQPSHFSNPDVLNLTPDSSDADRLERFFDSEDEDFEILSL
Sequence Length
393
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATG4B recombinant protein
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,598 Da
NCBI Official Full Name
cysteine protease ATG4B
NCBI Official Synonym Full Names
autophagy related 4B cysteine peptidase
NCBI Official Symbol
ATG4B
NCBI Official Synonym Symbols
APG4B
NCBI Protein Information
cysteine protease ATG4B
UniProt Protein Name
Cysteine protease ATG4B
Protein Family
UniProt Gene Name
ATG4B
UniProt Synonym Gene Names
APG4B; AUT2B; Autophagin-2B; cAut2B

Uniprot Description

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE). Has also an activity of delipidating enzyme for the PE-conjugated forms ().

Similar Products

Product Notes

The ATG4B atg4b (Catalog #AAA1420331) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393, Full length protein. The amino acid sequence is listed below: MDAATLTYDT LRFEYEDFPE TKEPVWILGR KYSVFTEKEE ILLDVTSRLW FTYRKNFPAI GGTGPTSDTG WGCMLRCGQM IFAQALVCRH LGRDWRWIKG KRQTDNYFSV LNAFIDKKDS YYSIHQIAQM GVGEGKSIGQ WYGPNTVAQV LKKLATFDTW SSLAVHIAMD NTVVMEEIRR LCQSNFSCAG AAACPAVEAD VLYNGYPEEA GVRDKLSLWK PLVLLIPLRL GLTEINEAYI ETLKHCFMMP QSLGVIGGKP NSAHYFIGYV GEELIYLDPH TTQPAVEPSD SGCLPDESFH CQHPPCRMSI AELDPSIAVG FFCHTEEDFN DWCHQIKKLS LVRGALPMFE LVERQPSHFS NPDVLNLTPD SSDADRLERF FDSEDEDFEI LSL. It is sometimes possible for the material contained within the vial of "Cysteine protease ATG4B (ATG4B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.