Protein Brevis radix-like 2 (BRXL2) Recombinant Protein | BRXL2 recombinant protein
Recombinant Arabidopsis thaliana Protein Brevis radix-like 2 (BRXL2)
Gene Names
ATBRXL2; BRX-LIKE2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Brevis radix-like 2 (BRXL2); Recombinant Arabidopsis thaliana Protein Brevis radix-like 2 (BRXL2); BRXL2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-374, Full length protein
Sequence
MLTCIACTKQLNTNNGGSKKQEEDEEEEDRVIETPRSKQIKSLTSQIKDMAVKASGAYKSCKPCSGSSNQNKNRSYADSDVASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTPESMSGRTESTVFMEEEDELKEWVAQVEPGVLITFVSLPEGGNDMKRIRFSREMFDKWQAQKWWAENFDKVMELYNVQQFNQQSVPLPTPPRSEDGSSRIQSTKNGPATPPLNKECSRGKGYASSGSLAHQPTTQTQSRHHDSSGLATTPKLSSISGTKTETSSVDESARSSFSREEEEADHSGEELSVSNASDIETEWVEQDEAGVYITIRALPDGTRELRRVRFSREKFGETNARLWWEQNRARIQQQYL
Sequence Length
374
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,863 Da
NCBI Official Full Name
DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein
NCBI Official Symbol
ATBRXL2
NCBI Official Synonym Symbols
BRX-LIKE2
NCBI Protein Information
DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein
UniProt Protein Name
Protein Brevis radix-like 2
Protein Family
UniProt Gene Name
BRXL2
UniProt Synonym Gene Names
AtBRXL2
NCBI Description
Belongs to five-member BRX gene family. Arabidopsis BRX genes share high levels of similarity among each others, with several conserved domains. The most distinct is BRX domain - highly conserved in all BRX genes among distantly related species. This protein-protein interaction domain is required and sufficient for BRX activity.
Similar Products
Product Notes
The BRXL2 brxl2 (Catalog #AAA1416747) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-374, Full length protein. The amino acid sequence is listed below: MLTCIACTKQ LNTNNGGSKK QEEDEEEEDR VIETPRSKQI KSLTSQIKDM AVKASGAYKS CKPCSGSSNQ NKNRSYADSD VASNSGRFRY AYKRAGSGSS TPKILGKEME SRLKGFLSGE GTPESMSGRT ESTVFMEEED ELKEWVAQVE PGVLITFVSL PEGGNDMKRI RFSREMFDKW QAQKWWAENF DKVMELYNVQ QFNQQSVPLP TPPRSEDGSS RIQSTKNGPA TPPLNKECSR GKGYASSGSL AHQPTTQTQS RHHDSSGLAT TPKLSSISGT KTETSSVDES ARSSFSREEE EADHSGEELS VSNASDIETE WVEQDEAGVY ITIRALPDGT RELRRVRFSR EKFGETNARL WWEQNRARIQ QQYL. It is sometimes possible for the material contained within the vial of "Protein Brevis radix-like 2 (BRXL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
