Zinc finger protein JAGGED-like (JGL) Recombinant Protein | JGL recombinant protein
Recombinant Arabidopsis thaliana Zinc finger protein JAGGED-like (JGL)
Gene Names
NUB; JAGGED-LIKE; JGL; NUBBIN; T6J4.23; T6J4_23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein JAGGED-like (JGL); Recombinant Arabidopsis thaliana Zinc finger protein JAGGED-like (JGL); JGL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-207, Full length protein
Sequence
MRADENNTLDLNNLPDDPSRDIFPFFEEGFSSSSSSGGFREKQTKDGKEYECRFCSLKFFKSQALGGHMNRHRQERETESLNKARELVLRNDSFPPHQGPPSFSYHQGDVHIGDLTQFKPMMYPPRHFSLPGSSSILQLQPPYLYPPLSSPFPQHNTNIGNNGTRHQTLTNSVCGGRALPDSSYTFIGAPVANGSRVAPHLPPHHGL
Sequence Length
207
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,150 Da
NCBI Official Full Name
C2H2 and C2HC zinc fingers superfamily protein
NCBI Official Symbol
NUB
NCBI Official Synonym Symbols
JAGGED-LIKE; JGL; NUBBIN; T6J4.23; T6J4_23
NCBI Protein Information
C2H2 and C2HC zinc fingers superfamily protein
UniProt Protein Name
Zinc finger protein JAGGED-like
Protein Family
UniProt Gene Name
JGL
UniProt Synonym Gene Names
NUB
NCBI Description
Along with JAG, it is involved in stamen and carpel development. Expression is limited to the adaxial side of lateral organs. Activated by AGAMOUS in a cal-1, ap1-1 background.
Uniprot Description
Acts with JAG to promote growth and patterning in stamens and carpels. Promotes the growth of the abaxial and adaxial sides of floral organs. Promotes the growth of the pollen-bearing microsporangia in anthers, the carpel walls of the gynoecium and the establishment of the correct number of cell layers in carpel walls. Promotes leaf blade growth and trichome development.
Similar Products
Product Notes
The JGL jgl (Catalog #AAA1411508) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-207, Full length protein. The amino acid sequence is listed below: MRADENNTLD LNNLPDDPSR DIFPFFEEGF SSSSSSGGFR EKQTKDGKEY ECRFCSLKFF KSQALGGHMN RHRQERETES LNKARELVLR NDSFPPHQGP PSFSYHQGDV HIGDLTQFKP MMYPPRHFSL PGSSSILQLQ PPYLYPPLSS PFPQHNTNIG NNGTRHQTLT NSVCGGRALP DSSYTFIGAP VANGSRVAPH LPPHHGL. It is sometimes possible for the material contained within the vial of "Zinc finger protein JAGGED-like (JGL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
