Amino acid--[acyl-carrier-protein] ligase (Atu2573) Recombinant Protein | Atu2573 recombinant protein
Recombinant Agrobacterium tumefaciens Amino acid--[acyl-carrier-protein] ligase (Atu2573)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Amino acid--[acyl-carrier-protein] ligase (Atu2573); Recombinant Agrobacterium tumefaciens Amino acid--[acyl-carrier-protein] ligase (Atu2573); Atu2573 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-327, Full length
Sequence
MTVFSAIPPISCWFTGRTPASWDKTMDMQTSFLDRLFEEGLLIETGVDGLYGRSGQFEDVIAAFERLIDRTGGADGAEAIRFPPGINRAYFEKSGYMKSFPQLAGTVHSFCGCELDHVSLLKSMDEGGDWTKDQKATDIVLTPAACYPLYPTIAKRGALPAGGGLYDIQSYCFRHEPSKDPARQQLFRMREYVCMGTESDVTEFRQTWMDRGVEMMKAVGLDVTIDIANDPFFGRAGKMLANNQRDQNLKFELLIPVTSATNPTACMSFNYHQDAFGQKWGLNLENGDVAHTACVGFGLERIALALFAHHGLDVKKWPAKVVETLWG
Sequence Length
327
Species
Agrobacterium tumefaciens (strain C58 / ATCC 33970)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,344 Da
NCBI Official Full Name
conserved hypothetical protein
NCBI Official Symbol
Atu2573
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Amino acid--[acyl-carrier-protein] ligase
Protein Family
UniProt Gene Name
Atu2573
UniProt Synonym Gene Names
aa:CP ligase
Uniprot Description
Catalyzes the ATP-dependent activation of L-alanine, and to a lesser extent of L-glycine and L-serine, and their transfer to the phosphopantetheine prosthetic group covalently attached to the vicinal carrier protein Atu2571 of yet unknown function. May participate in nonribosomal peptide synthesis or related processes. L-proline and L-glutamate are very poor substrates whereas D-amino acids are not substrates for ATP-dependent activation. Does not display tRNA aminoacylation activity.
Similar Products
Product Notes
The Atu2573 atu2573 (Catalog #AAA1410704) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-327, Full length. The amino acid sequence is listed below: MTVFSAIPPI SCWFTGRTPA SWDKTMDMQT SFLDRLFEEG LLIETGVDGL YGRSGQFEDV IAAFERLIDR TGGADGAEAI RFPPGINRAY FEKSGYMKSF PQLAGTVHSF CGCELDHVSL LKSMDEGGDW TKDQKATDIV LTPAACYPLY PTIAKRGALP AGGGLYDIQS YCFRHEPSKD PARQQLFRMR EYVCMGTESD VTEFRQTWMD RGVEMMKAVG LDVTIDIAND PFFGRAGKML ANNQRDQNLK FELLIPVTSA TNPTACMSFN YHQDAFGQKW GLNLENGDVA HTACVGFGLE RIALALFAHH GLDVKKWPAK VVETLWG. It is sometimes possible for the material contained within the vial of "Amino acid--[acyl-carrier-protein] ligase (Atu2573), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
