Y-box-binding protein 2 (YBX2) Recombinant Protein | YBX2 recombinant protein

Recombinant Human Y-box-binding protein 2 (YBX2)

Cat. Num. AAA1407409

• Gene Names: YBX2; DBPC; MSY2; CSDA3; CONTRIN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Y-box-binding protein 2 (YBX2); Recombinant Human Y-box-binding protein 2 (YBX2); YBX2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-364, Full length protein
• Sequence: MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
• Sequence Length: 364

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 156415990
• NCBI GeneID: 51087
• NCBI Accession #: NP_057066.2
• NCBI GenBank Nucleotide #: NM_015982.3
• UniProt Accession #: Q9Y2T7; Q8N4P0; D3DTP1
• Molecular Weight: 38,518 Da
• NCBI Official Full Name: Y-box-binding protein 2
• NCBI Official Synonym Full Names: Y-box binding protein 2
• NCBI Official Symbol: YBX2
• NCBI Official Synonym Symbols: DBPC; MSY2; CSDA3; CONTRIN
• NCBI Protein Information: Y-box-binding protein 2
• UniProt Protein Name: Y-box-binding protein 2
• Protein Family: Y-box-binding protein
• UniProt Gene Name: YBX2
• UniProt Synonym Gene Names: CSDA3; MSY2; Dbpc

NCBI Description

This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15. [provided by RefSeq, Feb 2012]

Uniprot Description

Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay ().