Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Histone-lysine N-methyltransferase SETMAR (SETMAR) Recombinant Protein | SETMAR recombinant protein

Recombinant Human Histone-lysine N-methyltransferase SETMAR (SETMAR)

Gene Names
SETMAR; Mar1; METNASE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase SETMAR (SETMAR); Recombinant Human Histone-lysine N-methyltransferase SETMAR (SETMAR); SETMAR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-671, Full length protein
Sequence
MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD
Sequence Length
671
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,124 Da
NCBI Official Full Name
histone-lysine N-methyltransferase SETMAR isoform 2
NCBI Official Synonym Full Names
SET domain and mariner transposase fusion gene
NCBI Official Symbol
SETMAR
NCBI Official Synonym Symbols
Mar1; METNASE
NCBI Protein Information
histone-lysine N-methyltransferase SETMAR
UniProt Protein Name
Histone-lysine N-methyltransferase SETMAR
UniProt Gene Name
SETMAR
UniProt Synonym Gene Names
Metnase

NCBI Description

This gene encodes a fusion protein that contains an N-terminal histone-lysine N-methyltransferase domain and a C-terminal mariner transposase domain. The encoded protein binds DNA and functions in DNA repair activities including non-homologous end joining and double strand break repair. The SET domain portion of this protein specifically methylates histone H3 lysines 4 and 36. This gene exists as a fusion gene only in anthropoid primates, other organisms lack mariner transposase domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

Protein derived from the fusion of a methylase with the transposase of an Hsmar1 transposon that plays a role in DNA double-strand break repair, stalled replication fork restart and DNA integration. DNA-binding protein, it is indirectly recruited to sites of DNA damage through protein-protein interactions. Has also kept a sequence-specific DNA-binding activity recognizing the 19-mer core of the 5'-terminal inverted repeats (TIRs) of the Hsmar1 element and displays a DNA nicking and end joining activity (PubMed:16332963, PubMed:16672366, PubMed:17877369, PubMed:17403897, PubMed:18263876, PubMed:22231448, PubMed:24573677, PubMed:20521842). In parallel, has a histone methyltransferase activity and methylates 'Lys-4' and 'Lys-36' of histone H3. Specifically mediates dimethylation of H3 'Lys-36' at sites of DNA double-strand break and may recruit proteins required for efficient DSB repair through non-homologous end-joining (PubMed:16332963, PubMed:21187428, PubMed:22231448). Also regulates replication fork processing, promoting replication fork restart and regulating DNA decatenation through stimulation of the topoisomerase activity of TOP2A (PubMed:18790802, PubMed:20457750).

Research Articles on SETMAR

Similar Products

Product Notes

The SETMAR setmar (Catalog #AAA1403924) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-671, Full length protein. The amino acid sequence is listed below: MAEFKEKPEA PTEQLDVACG QENLPVGAWP PGAAPAPFQY TPDHVVGPGA DIDPTQITFP GCICVKTPCL PGTCSCLRHG ENYDDNSCLR DIGSGGKYAE PVFECNVLCR CSDHCRNRVV QKGLQFHFQV FKTHKKGWGL RTLEFIPKGR FVCEYAGEVL GFSEVQRRIH LQTKSDSNYI IAIREHVYNG QVMETFVDPT YIGNIGRFLN HSCEPNLLMI PVRIDSMVPK LALFAAKDIV PEEELSYDYS GRYLNLTVSE DKERLDHGKL RKPCYCGAKS CTAFLPFDSS LYCPVEKSNI SCGNEKEPSM CGSAPSVFPS CKRLTLETMK MMLDKKQIRA IFLFEFKMGR KAAETTRNIN NAFGPGTANE RTVQWWFKKF CKGDESLEDE ERSGRPSEVD NDQLRAIIEA DPLTTTREVA EELNVNHSTV VRHLKQIGKV KKLDKWVPHE LTENQKNRRF EVSSSLILRN HNEPFLDRIV TCDEKWILYD NRRRSAQWLD QEEAPKHFPK PILHPKKVMV TIWWSAAGLI HYSFLNPGET ITSEKYAQEI DEMNQKLQRL QLALVNRKGP ILLHDNARPH VAQPTLQKLN ELGYEVLPHP PYSPDLLPTN YHVFKHLNNF LQGKRFHNQQ DAENAFQEFV ESQSTDFYAT GINQLISRWQ KCVDCNGSYF D. It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase SETMAR (SETMAR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.