Kinetochore protein Nuf2 (Nuf2) Recombinant Protein | Nuf2 recombinant protein
Recombinant Rat Kinetochore protein Nuf2 (Nuf2)
Gene Names
Nuf2; Cdca1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kinetochore protein Nuf2 (Nuf2); Recombinant Rat Kinetochore protein Nuf2 (Nuf2); Nuf2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-464, full length protein
Sequence
METLSFPRYNIAEIVVHIRNKLLTGADGKNLSKSDFLPNPKPEVLYMIYMRALQLVYGVRLEHFYMMPVNIEVMYPHIMEGFLPVSNLFFHLDSFMPICRVNDFEIADILYPKANRTSRFLSGIINFIHFRETCLEKYEEFLLQNKSSVDKIQQLSNAHQEALMKLEKLNSVPVEEQEEFKQLKDDIQELQHLLNQDFRQKTTLLQERYTKMKSDFSEKTKHVNELKLSVVSLKEVQDSLKSKIVDSPEKLKNYKEKMKDTVQKLRSAREEVMEKYDIYRDSVDCLPSCQLEVQLYQKKSQDLADNREKLSSILKESLNLEGQIDSDSSELKKLKTEENSLIRLMTLKKERLATMQFKINKKQEDVKQYKRTMIEDCNKVQEKRDAVCEQVTAINQDIHKIKSGIQQLRDAEKREKLKSQEILVDLKSALEKYHEGIEKTTEECCTRIGGKTAELKRRMFKMPP
Sequence Length
464
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nuf2 recombinant protein
This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,556 Da
NCBI Official Full Name
kinetochore protein Nuf2
NCBI Official Synonym Full Names
NUF2, NDC80 kinetochore complex component
NCBI Official Symbol
Nuf2
NCBI Official Synonym Symbols
Cdca1
NCBI Protein Information
kinetochore protein Nuf2
UniProt Protein Name
Kinetochore protein Nuf2
Protein Family
UniProt Gene Name
Nuf2
UniProt Synonym Gene Names
Cdca1
Uniprot Description
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.
Similar Products
Product Notes
The Nuf2 nuf2 (Catalog #AAA1394334) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-464, full length protein. The amino acid sequence is listed below: METLSFPRYN IAEIVVHIRN KLLTGADGKN LSKSDFLPNP KPEVLYMIYM RALQLVYGVR LEHFYMMPVN IEVMYPHIME GFLPVSNLFF HLDSFMPICR VNDFEIADIL YPKANRTSRF LSGIINFIHF RETCLEKYEE FLLQNKSSVD KIQQLSNAHQ EALMKLEKLN SVPVEEQEEF KQLKDDIQEL QHLLNQDFRQ KTTLLQERYT KMKSDFSEKT KHVNELKLSV VSLKEVQDSL KSKIVDSPEK LKNYKEKMKD TVQKLRSARE EVMEKYDIYR DSVDCLPSCQ LEVQLYQKKS QDLADNREKL SSILKESLNL EGQIDSDSSE LKKLKTEENS LIRLMTLKKE RLATMQFKIN KKQEDVKQYK RTMIEDCNKV QEKRDAVCEQ VTAINQDIHK IKSGIQQLRD AEKREKLKSQ EILVDLKSAL EKYHEGIEKT TEECCTRIGG KTAELKRRMF KMPP. It is sometimes possible for the material contained within the vial of "Kinetochore protein Nuf2 (Nuf2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
