Dehydrogenase/reductase SDR family member 9 (Dhrs9) Recombinant Protein | Dhrs9 recombinant protein
Recombinant Rat Dehydrogenase/reductase SDR family member 9 (Dhrs9)
Gene Names
Dhrs9; Rdhl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dehydrogenase/reductase SDR family member 9 (Dhrs9); Recombinant Rat Dehydrogenase/reductase SDR family member 9 (Dhrs9); Dhrs9 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-319, full length protein
Sequence
QLKIADIADKYIFITGCDSGFGNLAARTFDRKGFRVIAACLTESGSEALKAKTSERLHTVLLDVTNPENVKETAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTGLADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSSTSSVNLDLSLVVECMDHALTSLFPKTRYTAGKDAKTFWIPLSHMPAALQDFLLLKEKVELANPQAV
Sequence Length
299
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,214 Da
NCBI Official Full Name
dehydrogenase/reductase SDR family member 9
NCBI Official Synonym Full Names
dehydrogenase/reductase 9
NCBI Official Symbol
Dhrs9
NCBI Official Synonym Symbols
Rdhl
NCBI Protein Information
dehydrogenase/reductase SDR family member 9
UniProt Protein Name
Dehydrogenase/reductase SDR family member 9
Protein Family
UniProt Gene Name
Dhrs9
UniProt Synonym Gene Names
3-alpha-HSD
NCBI Description
catalyzes the conversion of retinol to retinal in retinoic acid biosynthesis [RGD, Feb 2006]
Uniprot Description
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH ().
Research Articles on Dhrs9
Similar Products
Product Notes
The Dhrs9 dhrs9 (Catalog #AAA1393081) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-319, full length protein. The amino acid sequence is listed below: QLKIADIADK YIFITGCDSG FGNLAARTFD RKGFRVIAAC LTESGSEALK AKTSERLHTV LLDVTNPENV KETAQWVKSH VGEKGLWGLI NNAGVLGVLA PTDWLTVDDY REPIEVNLFG LINVTLNMLP LVKKARGRVI NVSSIGGRLA FGGGGYTPSK YAVEGFNDSL RRDMKAFGVH VSCIEPGLFK TGLADPIKTT EKKLAIWKHL SPDIKQQYGE GYIEKSLHRL KSSTSSVNLD LSLVVECMDH ALTSLFPKTR YTAGKDAKTF WIPLSHMPAA LQDFLLLKEK VELANPQAV. It is sometimes possible for the material contained within the vial of "Dehydrogenase/reductase SDR family member 9 (Dhrs9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
