RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial Recombinant Protein | Ctdp1 recombinant protein

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

Cat. Num. AAA1391403

• Gene Names: Ctdp1; AW553592; 4930563P03Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1); partial; Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1); RNA polymerase II subunit A C-terminal domain phosphatase; EC=3.1.3.16; TFIIF-associating CTD phosphatase; Ctdp1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 178-341aa; Partial
• Sequence: HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

• Species: Mus musculus (Mouse)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for Ctdp1 recombinant protein

Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF)/CDK1 inactivation

Product Categories/Family for Ctdp1 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 34328280
• NCBI GeneID: 67655
• NCBI Accession #: NP_080571.2
• NCBI GenBank Nucleotide #: NM_026295.2
• UniProt Accession #: Q7TSG2; Q7TSS7; Q9D4S8
• Molecular Weight: 24 kDa
• NCBI Official Full Name: RNA polymerase II subunit A C-terminal domain phosphatase
• NCBI Official Synonym Full Names: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1
• NCBI Official Symbol: Ctdp1
• NCBI Official Synonym Symbols: AW553592; 4930563P03Rik
• NCBI Protein Information: RNA polymerase II subunit A C-terminal domain phosphatase; TFIIF-associating CTD phosphatase; CTD (carboxy-terminal domina, RNA polymerase II, polypeptide A) phosphatase, subunit 1
• UniProt Protein Name: RNA polymerase II subunit A C-terminal domain phosphatase
• UniProt Gene Name: Ctdp1
• UniProt Synonym Gene Names: Fcp1
• UniProt Entry Name: CTDP1_MOUSE

Uniprot Description

CTDP1: a phospho-serine/threonine protein phosphatase which interacts with the carboxy-terminus of transcription initiation factor TFIIF-alpha, a transcription factor which regulates elongation as well as initiation by RNA polymerase II. Its phosphorylation increases binding to TFIIF-alpha, affecting transcription elongation. Alternative splicing results in two different isoforms.

Protein type: Motility/polarity/chemotaxis; Transcription initiation complex; EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor)

Cellular Component: nucleoplasm; spindle pole; centrosome; cytoskeleton; cytoplasm; spindle; midbody; spindle midzone; nucleus; actin cytoskeleton

Molecular Function: protein binding; hydrolase activity; phosphoprotein phosphatase activity; CTD phosphatase activity

Biological Process: mitosis; cell division; protein amino acid dephosphorylation; cell cycle; exit from mitosis