Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Unconventional myosin-XVIIIb (MYO18B) Recombinant Protein | MYO18B recombinant protein

Recombinant Human Unconventional myosin-XVIIIb (MYO18B) , partial

Gene Names
MYO18B; KFS4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Unconventional myosin-XVIIIb (MYO18B); Recombinant Human Unconventional myosin-XVIIIb (MYO18B); partial; MYO18B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2420-2564. Partial.
Sequence
GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY
Sequence Length
2564
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MYO18B recombinant protein
This protein may regulate muscle-specific genes when in the nucleus and may influence intracellular trafficking when in the cytoplasm. The encoded protein functions as a homodimer and may interact with F actin. Mutations in this gene are associated with lung cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
233,671 Da
NCBI Official Full Name
unconventional myosin-XVIIIb isoform 1
NCBI Official Synonym Full Names
myosin XVIIIB
NCBI Official Symbol
MYO18B
NCBI Official Synonym Symbols
KFS4
NCBI Protein Information
unconventional myosin-XVIIIb
UniProt Protein Name
Unconventional myosin-XVIIIb
Protein Family
UniProt Gene Name
MYO18B

NCBI Description

The protein encoded by this gene may regulate muscle-specific genes when in the nucleus and may influence intracellular trafficking when in the cytoplasm. The encoded protein functions as a homodimer and may interact with F actin. Mutations in this gene are associated with lung cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

May be involved in intracellular trafficking of the muscle cell when in the cytoplasm, whereas entering the nucleus, may be involved in the regulation of muscle specific genes. May play a role in the control of tumor development and progression; restored MYO18B expression in lung cancer cells suppresses anchorage-independent growth.

Research Articles on MYO18B

Similar Products

Product Notes

The MYO18B myo18b (Catalog #AAA1388946) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2420-2564. Partial. The amino acid sequence is listed below: GSDPFSWKLP SLDYERKTKV DFDDFLPAIR KPQTPTSLAG SAKGGQDGSQ RSSIHFETEE ANRSFLSGIK TILKKSPEPK EDPAHLSDSS SSSGSIVSFK SADSIKSRPG IPRLAGDGGE RTSPERREPG TGRKDDDVAS IMKKY . It is sometimes possible for the material contained within the vial of "Unconventional myosin-XVIIIb (MYO18B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.