DEAD-box ATP-dependent RNA helicase 2 (RH2) Recombinant Protein | RH2 recombinant protein

Recombinant Arabidopsis thaliana DEAD-box ATP-dependent RNA helicase 2 (RH2)

Cat. Num. AAA1387925

• Gene Names: EIF4A-III; eukaryotic initiation factor 4A-III
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DEAD-box ATP-dependent RNA helicase 2 (RH2); Recombinant Arabidopsis thaliana DEAD-box ATP-dependent RNA helicase 2 (RH2); RH2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-408, Full length protein
• Sequence: MATANPGRGGGRRGGGAMDDDKLVFETTDGIEPITSFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQSGTGKTSMIALSVCQVVDTSSREVQALILSPTRELATQTEKTIQAIGLHANIQAHACIGGNSVGEDIRKLEHGVHVVSGTPGRVCDMIKRRSLRTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKFMTEPVKILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDYLSEKMRSHNFTVSSMHGDMPQKERDAIMNEFRSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIKILRDIEQYYSTQIDEMPMNVADLI
• Sequence Length: 408

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15230945
• NCBI GeneID: 821513
• NCBI Accession #: NP_188610.1
• NCBI GenBank Nucleotide #: NM_112866.4
• UniProt Accession #: Q94A52; Q9ZS14
• Molecular Weight: 45,845 Da
• NCBI Official Full Name: eukaryotic initiation factor 4A-III
• NCBI Official Symbol: EIF4A-III
• NCBI Official Synonym Symbols: eukaryotic initiation factor 4A-III
• NCBI Protein Information: eukaryotic initiation factor 4A-III
• UniProt Protein Name: Eukaryotic initiation factor 4A-III homolog
• Protein Family: Opsin
• UniProt Gene Name: EIF4A3
• UniProt Synonym Gene Names: AtRH02

NCBI Description

Encodes an RNA helicase that may be a component of the Exon Junction Complex. Subcellular localization is modulated by stress. Under normal conditions it is localized to the nuceloplasm but under hyopoxic conditions it localizes to the nucleolus and splicing speckles.

Uniprot Description

ATP-dependent RNA helicase. Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its RNA-dependent ATPase and RNA-helicase activities are induced by MLN51/CASC3, but abolished in presence of the MAGO-Y14 heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The inhibition of ATPase activity by the MAGO-Y14 heterodimer increases the RNA-binding affinity of the EJC (). Plays a role in abiotic stress adaptation. Can regulate abiotic stress resistance partially via the control of acetoacetyl-CoA thiolase 2 (AC Q8S4Y1) expression (PubMed:26883227).