Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome P450 4A22 (CYP4A22) Recombinant Protein | CYP4A22 recombinant protein

Recombinant Human Cytochrome P450 4A22 (CYP4A22)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome P450 4A22 (CYP4A22); Recombinant Human Cytochrome P450 4A22 (CYP4A22); CYP4A22 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
5-519, Full length protein
Sequence
VLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL
Sequence Length
515
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CYP4A22 recombinant protein
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,922 Da
NCBI Official Full Name
cytochrome P450 4A22 isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 4 subfamily A member 22
NCBI Official Symbol
CYP4A22
NCBI Protein Information
cytochrome P450 4A22
UniProt Protein Name
Cytochrome P450 4A22
Protein Family
UniProt Gene Name
CYP4A22

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate and palmitate. Shows no activity towards arachidonic acid and prostaglandin A1. Lacks functional activity in the kidney and does not contribute to renal 20-hydroxyeicosatetraenoic acid (20-HETE) biosynthesis.

Research Articles on CYP4A22

Similar Products

Product Notes

The CYP4A22 cyp4a22 (Catalog #AAA1386165) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 5-519, Full length protein. The amino acid sequence is listed below: VLSPSRRLGG VSGILQVTSL LILLLLLIKA AQLYLHRQWL LKALQQFPCP PSHWLFGHIQ EFQHDQELQR IQERVKTFPS ACPYWIWGGK VRVQLYDPDY MKVILGRSDP KSHGSYKFLA PRIGYGLLLL NGQTWFQHRR MLTPAFHNDI LKPYVGLMAD SVRVMLDKWE ELLGQDSPLE VFQHVSLMTL DTIMKSAFSH QGSIQVDRNS QSYIQAISDL NSLVFCCMRN AFHENDTIYS LTSAGRWTHR ACQLAHQHTD QVIQLRKAQL QKEGELEKIK RKRHLDFLDI LLLAKMENGS ILSDKDLRAE VDTFMFEGHD TTASGISWIL YALATHPKHQ ERCREEIHGL LGDGASITWN HLDQMPYTTM CIKEALRLYP PVPGIGRELS TPVTFPDGRS LPKGIMVLLS IYGLHHNPKV WPNLEVFDPS RFAPGSAQHS HAFLPFSGGS RNCIGKQFAM NQLKVARALT LLRFELLPDP TRIPIPMARL VLKSKNGIHL RLRRLPNPCE DKDQL. It is sometimes possible for the material contained within the vial of "Cytochrome P450 4A22 (CYP4A22), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.