Ubiquitin-conjugating enzyme E2 variant 2 Recombinant Protein | UBE2V2 recombinant protein

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2

Cat. Num. AAA1382973

• Gene Names: UBE2V2; MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 variant 2; Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; Enterocyte differentiation-associated factor 1; EDAF-1; Enterocyte differentiation-promoting factor 1; EDPF-1; MMS2 homolog; Vitamin D3-inducible protein; UBE2V2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-145aa; Full Length
• Sequence: AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
• Sequence Length: 145

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for UBE2V2 recombinant protein

Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Product Categories/Family for UBE2V2 recombinant protein

Epigenetics and Nuclear Signaling

References

Molecular Cloning of a 1alpha,25-dihydroxyvitamin D3 inducible transcript (DDVit 1)

NCBI and Uniprot Product Information

• NCBI GI #: 4507797
• NCBI GeneID: 7336
• NCBI Accession #: NP_003341.1
• NCBI GenBank Nucleotide #: NM_003350.2
• UniProt Accession #: Q15819
• Molecular Weight: 32.2 kDa
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 variant 2
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 variant 2
• NCBI Official Symbol: UBE2V2
• NCBI Official Synonym Symbols: MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 variant 2
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 variant 2
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2V2
• UniProt Synonym Gene Names: MMS2; UEV2; EDAF-1; EDPF-1
• UniProt Entry Name: UB2V2_HUMAN

NCBI Description

Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

UBE2V2: Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 8q11.21

Cellular Component: cytoplasm; nucleoplasm; nucleus; UBC13-MMS2 complex

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: cell proliferation; DNA double-strand break processing; DNA repair; double-strand break repair; double-strand break repair via homologous recombination; double-strand break repair via nonhomologous end joining; error-free postreplication DNA repair; nucleotide-excision repair; postreplication repair; protein polyubiquitination; protein ubiquitination; regulation of DNA repair