Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Autophagy-related protein 3 (atg-3) Recombinant Protein | atg-3 recombinant protein

Recombinant Neurospora crassa Autophagy-related protein 3 (atg-3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 3 (atg-3); Recombinant Neurospora crassa Autophagy-related protein 3 (atg-3); atg-3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-352, Full length
Sequence
MNFLRSTAATLLDKYTPVSHTSTFRNTGQITPEEFVAAGDYLTFKFPSWSWADADSPSKRLPFLPPGKQFLVTRHVPCHRRLNDDFAGDAGHEEALVEGNKGGADDDGWLRTGSMTSSQPLRVREVRTVDDAGNVGDREVVDEDDIPDMEDDDDDEAIIRAEGDNSNRQDNISTGKRTYTLYITYANAYKCPRMYMSGYLSNGQPLPPHLMMEDIVGDYKDKTVTLEDFPFFSHSVKMASVHPCRHASVMKTLLDRADAALKLRREKMKAGQGSGSEQGMEGLVDEINKLDVSGAHANAVEAAPGEDAEWEEVPHDVADQEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV
Sequence Length
352
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,311 Da
NCBI Official Full Name
autophagocytosis protein Aut1
NCBI Official Symbol
NCU01955
NCBI Protein Information
autophagocytosis protein Aut1
UniProt Protein Name
Autophagy-related protein 3
UniProt Gene Name
apg-3
UniProt Synonym Gene Names
atg3

Uniprot Description

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of apg-6/atg8. The atg12-apg-4/atg5 conjugate plays a role of an E3 and promotes the transfer of apg-6/atg8 from apg-3/atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of apg-6/atg8. The formation of the apg-6/atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The apg-6/atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy ().

Similar Products

Product Notes

The atg-3 apg-3 (Catalog #AAA1380781) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-352, Full length. The amino acid sequence is listed below: MNFLRSTAAT LLDKYTPVSH TSTFRNTGQI TPEEFVAAGD YLTFKFPSWS WADADSPSKR LPFLPPGKQF LVTRHVPCHR RLNDDFAGDA GHEEALVEGN KGGADDDGWL RTGSMTSSQP LRVREVRTVD DAGNVGDREV VDEDDIPDME DDDDDEAIIR AEGDNSNRQD NISTGKRTYT LYITYANAYK CPRMYMSGYL SNGQPLPPHL MMEDIVGDYK DKTVTLEDFP FFSHSVKMAS VHPCRHASVM KTLLDRADAA LKLRREKMKA GQGSGSEQGM EGLVDEINKL DVSGAHANAV EAAPGEDAEW EEVPHDVADQ EVAIRVDQYL VVFLKFIASV TPGIEHDFTM GV. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 3 (atg-3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.