Ubiquitin-conjugating enzyme E2 variant 1D (UEV1D) Recombinant Protein | UEV1D recombinant protein
Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1D (UEV1D)
Gene Names
UEV1D-4; F3C22.2; MMS2 ZWEI HOMOLOGUE 4; MMZ4; UBIQUITIN E2 VARIANT 1D; ubiquitin E2 variant 1D-4; UEV1D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-conjugating enzyme E2 variant 1D (UEV1D); Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1D (UEV1D); UEV1D recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-146, Full length protein
Sequence
MTLGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDILVQLKKEMSTSHNRKLVQPPEGTCF
Sequence Length
146
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,782 Da
NCBI Official Full Name
ubiquitin E2 variant 1D-4
NCBI Official Symbol
UEV1D-4
NCBI Official Synonym Symbols
F3C22.2; MMS2 ZWEI HOMOLOGUE 4; MMZ4; UBIQUITIN E2 VARIANT 1D; ubiquitin E2 variant 1D-4; UEV1D
NCBI Protein Information
ubiquitin E2 variant 1D-4
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 variant 1D
Protein Family
UniProt Gene Name
UEV1D
UniProt Synonym Gene Names
MMZ4; Ubc enzyme variant 1D
Uniprot Description
Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. Involved in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Research Articles on UEV1D
Similar Products
Product Notes
The UEV1D uev1d (Catalog #AAA1380002) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-146, Full length protein. The amino acid sequence is listed below: MTLGSGGSSV VVPRNFRLLE ELERGEKGIG DGTVSYGMDD GDDIYMRSWT GTIIGPHNTV HEGRIYQLKL FCDKDYPEKP PTVRFHSRVN MACVNHETGV VDPKKFGLLA NWQREYTMED ILVQLKKEMS TSHNRKLVQP PEGTCF. It is sometimes possible for the material contained within the vial of "Ubiquitin-conjugating enzyme E2 variant 1D (UEV1D), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
