Protein FIZZY-RELATED 3 (FZR3) Recombinant Protein | FZR3 recombinant protein
Recombinant Arabidopsis thaliana Protein FIZZY-RELATED 3 (FZR3)
Gene Names
FZR3; CCS52B; cell cycle switch protein 52 B; FIZZY-related 3; MAC12.21; MAC12_21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein FIZZY-RELATED 3 (FZR3); Recombinant Arabidopsis thaliana Protein FIZZY-RELATED 3 (FZR3); FZR3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-481, Full length protein
Sequence
MASPQSTKTGLNLPAGMNQTSLRLETFSSSFRGISSLSSPSKSTCSDRFIPCRSSSRLHAFDLQDKEPTTPVKEGGNEAYSRLLKSELFGSDFASPLLSPAGGQGSASSPMSPCTNMLRFKTDRSNSSPSSPFSPSILGNDNGHSSDSSPPPKPPRKVPKTPHKVLDAPSLQDDFYLNVVDWSSQNVLAVGLGTCVYLWTASNSKVTKLCDLGPNDSVCSVQWTREGSYISIGTSHGQVQVWDGTQCKRVRTMGGHQTRTGVLAWNSRILSSGSRDRNILQHDIRVQSDFVSKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVWNNHSQQPILKLTEHTAAVKAITWSPHQSSLLASGGGTADRCIRFWNTTNGNQLNSIDTGSQVCNLAWSKNVNEIVSTHGYSQNQIMLWKYPSMSKVATLTGHSMRVLYLATSPDGQTIVTGAGDETLRFWNVFPSVKMQTPVKDTGLWSLGRTQIR
Sequence Length
481
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,378 Da
NCBI Official Full Name
FIZZY-related 3
NCBI Official Symbol
FZR3
NCBI Official Synonym Symbols
CCS52B; cell cycle switch protein 52 B; FIZZY-related 3; MAC12.21; MAC12_21
NCBI Protein Information
FIZZY-related 3
UniProt Protein Name
Protein FIZZY-RELATED 3
Protein Family
UniProt Gene Name
FZR3
UniProt Synonym Gene Names
CCS52B; CDH1-3
Uniprot Description
Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Research Articles on FZR3
Similar Products
Product Notes
The FZR3 fzr3 (Catalog #AAA1373230) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-481, Full length protein. The amino acid sequence is listed below: MASPQSTKTG LNLPAGMNQT SLRLETFSSS FRGISSLSSP SKSTCSDRFI PCRSSSRLHA FDLQDKEPTT PVKEGGNEAY SRLLKSELFG SDFASPLLSP AGGQGSASSP MSPCTNMLRF KTDRSNSSPS SPFSPSILGN DNGHSSDSSP PPKPPRKVPK TPHKVLDAPS LQDDFYLNVV DWSSQNVLAV GLGTCVYLWT ASNSKVTKLC DLGPNDSVCS VQWTREGSYI SIGTSHGQVQ VWDGTQCKRV RTMGGHQTRT GVLAWNSRIL SSGSRDRNIL QHDIRVQSDF VSKLVGHKSE VCGLKWSHDD RELASGGNDN QLLVWNNHSQ QPILKLTEHT AAVKAITWSP HQSSLLASGG GTADRCIRFW NTTNGNQLNS IDTGSQVCNL AWSKNVNEIV STHGYSQNQI MLWKYPSMSK VATLTGHSMR VLYLATSPDG QTIVTGAGDE TLRFWNVFPS VKMQTPVKDT GLWSLGRTQI R. It is sometimes possible for the material contained within the vial of "Protein FIZZY-RELATED 3 (FZR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
