ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1) Recombinant Protein | ATPAF1 recombinant protein
Recombinant Human ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1)
Gene Names
ATPAF1; ATP11; ATP11p
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1); Recombinant Human ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1); ATPAF1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
58-328, Full length protein
Sequence
GGADSSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
Sequence Length
271
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATPAF1 recombinant protein
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,438 Da
NCBI Official Full Name
ATP synthase mitochondrial F1 complex assembly factor 1 isoform 2
NCBI Official Synonym Full Names
ATP synthase mitochondrial F1 complex assembly factor 1
NCBI Official Symbol
ATPAF1
NCBI Official Synonym Symbols
ATP11; ATP11p
NCBI Protein Information
ATP synthase mitochondrial F1 complex assembly factor 1
UniProt Protein Name
ATP synthase mitochondrial F1 complex assembly factor 1
Protein Family
UniProt Gene Name
ATPAF1
UniProt Synonym Gene Names
ATP11
NCBI Description
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]
Uniprot Description
May play an essential role for the assembly of the mitochondrial F1-F0 complex.
Research Articles on ATPAF1
Similar Products
Product Notes
The ATPAF1 atpaf1 (Catalog #AAA1372575) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 58-328, Full length protein. The amino acid sequence is listed below: GGADSSGVGA EAELQANPFY DRYRDKIQLL RRSDPAAFES RLEKRSEFRK QPVGHSRQGD FIKCVEQKTD ALGKQSVNRG FTKDKTLSSI FNIEMVKEKT AEEIKQIWQQ YFAAKDTVYA VIPAEKFDLI WNRAQSCPTF LCALPRREGY EFFVGQWTGT ELHFTALINI QTRGEAAASQ LILYHYPELK EEKGIVLMTA EMDSTFLNVA EAQCIANQVQ LFYATDRKET YGLVETFNLR PNEFKYMSVI AELEQSGLGA ELKCAQNQNK T. It is sometimes possible for the material contained within the vial of "ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
