Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Heterogeneous nuclear ribonucleoprotein K (HNRNPK) Recombinant Protein | HNRNPK recombinant protein

Recombinant Chicken Heterogeneous nuclear ribonucleoprotein K (HNRNPK)

Gene Names
HNRNPKL; HNRPK; HNRNPK
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein K (HNRNPK); Recombinant Chicken Heterogeneous nuclear ribonucleoprotein K (HNRNPK); HNRNPK recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-427, Full length protein
Sequence
METEQQEETFTNTETNGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADTETIGEILKKIIPTLEEYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPNRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMSYDRRGRPGDRYDGMMMQCHVDACDDMQPPELFEGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Sequence Length
427
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HNRNPK recombinant protein
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,278 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein K
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein K-like
NCBI Official Symbol
HNRNPKL
NCBI Official Synonym Symbols
HNRPK; HNRNPK
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein K
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein K
UniProt Gene Name
HNRNPK
UniProt Synonym Gene Names
HNRPK; hnRNP K

Uniprot Description

One of the major pre-mRNA-binding proteins. Binds tenaciously to poly(C) sequences. Likely to play a role in the nuclear metabolism of hnRNAs, particularly for pre-mRNAs that contain cytidine-rich sequences. Can also bind poly(C) single-stranded DNA. May play an important role in p53/TP53 response to DNA damage, acting at the level of both transcription activation and repression ().

Similar Products

Product Notes

The HNRNPK hnrnpk (Catalog #AAA1367291) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-427, Full length protein. The amino acid sequence is listed below: METEQQEETF TNTETNGKRP AEDMEEEQAF KRSRNTDEMV ELRILLQSKN AGAVIGKGGK NIKALRTDYN ASVSVPDSSG PERILSISAD TETIGEILKK IIPTLEEYQH YKGSDFDCEL RLLIHQSLAG GIIGVKGAKI KELRENTQTT IKLFQECCPH STDRVVLIGG KPDRVVECIK IILDLISESP IKGRAQPYDP NFYDETYDYG GFTMMFDDRR GRPVGFPMRG RGGFDRMPPN RGGRPMPPSR RDYDDMSPRR GPPPPPPGRG GRGGSRARNL PLPPPPPPRG GDLMSYDRRG RPGDRYDGMM MQCHVDACDD MQPPELFEGG SGYDYSYAGG RGSYGDLGGP IITTQVTIPK DLAGSIIGKG GQRIKQIRHE SGASIKIDEP LEGSEDRIIT ITGTQDQIQN AQYLLQNSVK QYSGKFF. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein K (HNRNPK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.