SDS-PAGE
Matrix protein VP40 (VP40) Recombinant Protein | VP40 recombinant protein
Recombinant Reston ebolavirus Matrix protein VP40 (VP40)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix protein VP40 (VP40); Recombinant Reston ebolavirus Matrix protein VP40 (VP40); Matrix protein VP40; Membrane-associated protein VP40; VP40 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-331aa; Full Length
Sequence
MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVASAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGPGIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLHPKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKNGQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ
Sequence Length
331
Species
Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for VP40 recombinant protein
Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51.8 kDa
NCBI Official Full Name
matrix protein
NCBI Official Symbol
VP40
NCBI Protein Information
matrix protein
UniProt Protein Name
Matrix protein VP40
Protein Family
UniProt Gene Name
VP40
UniProt Entry Name
VP40_EBORR
Uniprot Description
Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication ().
Research Articles on VP40
Similar Products
Product Notes
The VP40 vp40 (Catalog #AAA1364343) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-331aa; Full Length. The amino acid sequence is listed below: MRRGVLPTAP PAYNDIAYPM SILPTRPSVI VNETKSDVLA VPGADVPSNS MRPVADDNID HSSHTPSGVA SAFILEATVN VISGTKVLMK QIPIWLPLGV ADQKIYSFDS TTAAIMLASY TVTHFGKISN PLVRVNRLGP GIPDHPLRLL RLGNQAFLQE FVLPPVQLPQ YFTFDLTALK LITQPLPAAT WTDETPAGAV NALRPGLSLH PKLRPILLPG KTGKKGHASD LTSPDKIQTI MNAIPDLKIV PIDPTKNIVG IEVPELLVQR LTGKKPQPKN GQPIIPVLLP KYVGLDPISP GDLTMVITQD CDSCHSPASH PYHMDKQNSY Q. It is sometimes possible for the material contained within the vial of "Matrix protein VP40 (VP40), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
