Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Histone-binding protein RBBP7 (RBBP7) Recombinant Protein | RBBP7 recombinant protein

Recombinant Bovine Histone-binding protein RBBP7 (RBBP7)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-binding protein RBBP7 (RBBP7); Recombinant Bovine Histone-binding protein RBBP7 (RBBP7); RBBP7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-425, full length protein
Sequence
ASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSEKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTPELEGQGS
Sequence Length
424
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RBBP7 recombinant protein
This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,844 Da
NCBI Official Full Name
histone-binding protein RBBP7
NCBI Official Synonym Full Names
RB binding protein 7, chromatin remodeling factor
NCBI Official Symbol
RBBP7
NCBI Protein Information
histone-binding protein RBBP7
UniProt Protein Name
Histone-binding protein RBBP7
Protein Family
UniProt Gene Name
RBBP7
UniProt Synonym Gene Names
RBBP-7

Uniprot Description

Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex ().

Similar Products

Product Notes

The RBBP7 rbbp7 (Catalog #AAA1360279) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-425, full length protein. The amino acid sequence is listed below: ASKEMFEDTV EERVINEEYK IWKKNTPFLY DLVMTHALQW PSLTVQWLPE VTKPEGKDYA LHWLVLGTHT SDEQNHLVVA RVHIPNDDAQ FDASHCDSEK GEFGGFGSVT GKIECEIKIN HEGEVNRARY MPQNPHIIAT KTPSSDVLVF DYTKHPAKPD PSGECNPDLR LRGHQKEGYG LSWNSNLSGH LLSASDDHTV CLWDINAGPK EGKIVDAKAI FTGHSAVVED VAWHLLHESL FGSVADDQKL MIWDTRSNTT SKPSHLVDAH TAEVNCLSFN PYSEFILATG SADKTVALWD LRNLKLKLHT FESHKDEIFQ VHWSPHNETI LASSGTDRRL NVWDLSKIGE EQSAEDAEDG PPELLFIHGG HTAKISDFSW NPNEPWVICS VSEDNIMQIW QMAENIYNDE ESDVTTPELE GQGS. It is sometimes possible for the material contained within the vial of "Histone-binding protein RBBP7 (RBBP7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.