Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc finger protein SNAI2 (SNAI2) Recombinant Protein | SNAI2 recombinant protein

Recombinant Bovine Zinc finger protein SNAI2 (SNAI2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein SNAI2 (SNAI2); Recombinant Bovine Zinc finger protein SNAI2 (SNAI2); SNAI2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-268, full length protein
Sequence
MPRSFLVKKHFNASKKPNYSELDTHTVIISPCLYEGYPVPVIPQPEVLRSGAYSPIAVWTTASPFHAPLPAGLSPLSGYPASLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLGKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCSHCSRAFADRSNLRAHLQTHSDVKKYQCKSCSKTFSRMSLLHKHEESGCCAAH
Sequence Length
268
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SNAI2 recombinant protein
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,729 Da
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
Protein Family
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG

Uniprot Description

Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis ().

Similar Products

Product Notes

The SNAI2 snai2 (Catalog #AAA1357893) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-268, full length protein. The amino acid sequence is listed below: MPRSFLVKKH FNASKKPNYS ELDTHTVIIS PCLYEGYPVP VIPQPEVLRS GAYSPIAVWT TASPFHAPLP AGLSPLSGYP ASLGRVSPPP PSDTSSKDHS GSESPISDEE ERLQSKLSDP HAIEAEKFQC NLCNKTYSTF SGLGKHKQLH CDAQSRKSFS CKYCDKEYVS LGALKMHIRT HTLPCVCKIC GKAFSRPWLL QGHIRTHTGE KPFSCSHCSR AFADRSNLRA HLQTHSDVKK YQCKSCSKTF SRMSLLHKHE ESGCCAAH. It is sometimes possible for the material contained within the vial of "Zinc finger protein SNAI2 (SNAI2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.