Ubiquitin-conjugating enzyme E2 variant 1B (UEV1B) Recombinant Protein | UEV1B recombinant protein

Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1B (UEV1B)

Cat. Num. AAA1356085

• Gene Names: MMZ2; F5A18.16; F5A18_16; MMS ZWEI homologue 2; UBIQUITIN E2 VARIANT 1B; UEV1B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 variant 1B (UEV1B); Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1B (UEV1B); UEV1B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-159, Full length protein
• Sequence: MGSEEEKVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDILMQSWTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTVRFQSRINMACVNPENGVVDPSHFPMLSNWRREFTMEDLLIQLKKEMMSSQNRKLAQPLEGNEEGRTDPKGLVVKCCVM
• Sequence Length: 159

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18409647
• NCBI GeneID: 843403
• NCBI Accession #: NP_564994.1
• NCBI GenBank Nucleotide #: NM_105734.3
• UniProt Accession #: Q9CAB6; Q8L9N0
• Molecular Weight: 18,001 Da
• NCBI Official Full Name: MMS ZWEI homologue 2
• NCBI Official Symbol: MMZ2
• NCBI Official Synonym Symbols: F5A18.16; F5A18_16; MMS ZWEI homologue 2; UBIQUITIN E2 VARIANT 1B; UEV1B
• NCBI Protein Information: MMS ZWEI homologue 2
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 variant 1B
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UEV1B
• UniProt Synonym Gene Names: MMZ2; Ubc enzyme variant 1B

NCBI Description

MMZ2/UEV1B encodes a protein that may play a role in DNA damage responses and error-free post-replicative DNA repair by participating in lysine-63-based polyubiquitination reactions. UEV1A can form diubiquitin and triubiquitin chains in combination with UBC13A/UBC35 in vitro. It can also functionally complement an mms2 mutation in budding yeast, both by increasing mms2 mutant viability in the presence of the DNA damaging agent MMS, and by reducing the rate of spontaneous DNA mutation. However, a combination of MMZ2/UEV1B and UBC13A do not do a good job of rescuing an mms2 ubc13 double mutant in yeast. MMZ2/UEV1B transcripts are found in most plant organs, but not in the pollen or in seedlings 6 hours or 2 days post-germination. The transcript levels do not appear to be stress-inducible.

Uniprot Description

Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. May play a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.