Thrombin-like enzyme BjussuSP-1 Recombinant Protein | SVTLE BjussuSP-1 recombinant protein
Recombinant Bothrops jararacussu Thrombin-like enzyme BjussuSP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thrombin-like enzyme BjussuSP-1; Recombinant Bothrops jararacussu Thrombin-like enzyme BjussuSP-1; SVTLE BjussuSP-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-232, Full length protein
Sequence
VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Sequence Length
232
Species
Bothrops jararacussu (Jararacussu)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
25,163 Da
NCBI Official Full Name
Thrombin-like enzyme BjussuSP-1
UniProt Protein Name
Thrombin-like enzyme BjussuSP-1
Protein Family
UniProt Gene Name
SVTLE BjussuSP-1
UniProt Synonym Gene Names
SVSP; SVTLE BjussuSP-I
Uniprot Description
Thrombin-like enzyme that shows clotting activity upon human plasma. Shows specific fibrinogenolytic activity for Aalpha chain (FGA). Hydrolyzes fibrin, BAPNA and TAME, as well as chromogenic artificial substrates of the blood coagulation cascasde: S-27654 for factor X (F10), S-2302 for kallikrein (KLK), factor XIa (F11), and XIIa (F12), and S-2266 for kallikrein and factor XIa (F11). Subcutaneous injection into mice induces a mild edema. Intravenous and intramuscular injection reduce plasma fibrinogen concentration and increase the levels of fibrin(ogen) degradation products. Intramuscular injection also promotes an increase in the expression of proMMP-9, but is unable to activate it.
Similar Products
Product Notes
The Thrombin-like enzyme BjussuSP-1 svtle bjussusp-1 (Catalog #AAA1353010) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-232, Full length protein. The amino acid sequence is listed below: VLGGDECDIN EHPFLAFLYS HGYFCGLTLI NQEWVVTAAH CDSTNFQMQL GVHSKKVLNE DEQTRNPKEK FICPNKNMSE VLDKDIMLIK LDKPISNSKH IAPLSLPSNP PSVGSVCRIM GWGSITIPNE TYPDVPYCAN INLVDYEVCQ GAYNGLPAKT TLCAGVLEGG KDTCVGDSGG PLICNGQFQG IVSYGAHSCG QGPKPGIYTN VFDYTDWIQR NIAGNTDATC PP. It is sometimes possible for the material contained within the vial of "Thrombin-like enzyme BjussuSP-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
