Nuclear transcription factor Y subunit A-3 Recombinant Protein | NFYA3 recombinant protein

Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3

Cat. Num. AAA1350443

• Gene Names: NF-YA3; ATHAP2C; F3N23.3; F3N23_3; HAP2C; NF-YA3; nuclear factor Y; subunit A3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nuclear transcription factor Y subunit A-3; Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3; Transcriptional activator HAP2; C; NFYA3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-340aa; Full Length
• Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
• Sequence Length: 340

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NFYA3 recombinant protein

Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

References

Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis.Edwards D., Murray J.A.H., Smith A.G.Plant Physiol. 117:1015-1022(1998) Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K., Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.Nature 408:816-820(2000) The Arabidopsis Information Resource (TAIR) Empirical analysis of transcriptional activity in the Arabidopsis genome.Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G., Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.Science 302:842-846(2003) Regulation of the CCAAT-binding NF-Y subunits in Arabidopsis thaliana.Gusmaroli G., Tonelli C., Mantovani R.Gene 264:173-185(2001) Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.Gusmaroli G., Tonelli C., Mantovani R.Gene 283:41-48(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 18410195
• NCBI GeneID: 843614
• NCBI Accession #: NP_565049.1
• NCBI GenBank Nucleotide #: NM_105941.7
• UniProt Accession #: Q93ZH2; O23632; Q9SSP3
• Molecular Weight: 41.6 kDa
• NCBI Official Full Name: nuclear transcription factor Y subunit A-3
• NCBI Official Symbol: NF-YA3
• NCBI Official Synonym Symbols: ATHAP2C; F3N23.3; F3N23_3; HAP2C; NF-YA3; nuclear factor Y; subunit A3
• NCBI Protein Information: nuclear transcription factor Y subunit A-3
• UniProt Protein Name: Nuclear transcription factor Y subunit A-3
• Protein Family: Nuclear transcription factor
• UniProt Gene Name: NFYA3
• UniProt Synonym Gene Names: HAP2C; AtNF-YA-3
• UniProt Entry Name: NFYA3_ARATH

NCBI Description

Encodes a subunit of CCAAT-binding complex, binds to CCAAT box motif present in some plant promoter sequences. One of three members of this class (HAP2A, HAP2B, HAP2C), it is expressed in vegetative and reproductive tissues.

Uniprot Description

Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.