Apoptosis-inducing factor 2 (Aifm2) Recombinant Protein | Aifm2 recombinant protein

Recombinant Mouse Apoptosis-inducing factor 2 (Aifm2), partial

Cat. Num. AAA1344778

• Gene Names: Aifm2; Amid; PRG3; 5430437E11Rik; D730001I10Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apoptosis-inducing factor 2 (Aifm2); Recombinant Mouse Apoptosis-inducing factor 2 (Aifm2); partial; Aifm2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-373. Partial
• Sequence: SQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Aifm2 recombinant protein

This protein has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8
AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells.

NCBI and Uniprot Product Information

• NCBI GI #: 85861162
• NCBI GeneID: 71361
• NCBI Accession #: NP_001034283.1
• NCBI GenBank Nucleotide #: NM_001039194.3
• UniProt Accession #: Q8BUE4; Q8CHZ2
• Molecular Weight: 41,356 Da
• NCBI Official Full Name: apoptosis-inducing factor 2 isoform 2
• NCBI Official Synonym Full Names: apoptosis-inducing factor, mitochondrion-associated 2
• NCBI Official Symbol: Aifm2
• NCBI Official Synonym Symbols: Amid; PRG3; 5430437E11Rik; D730001I10Rik
• NCBI Protein Information: apoptosis-inducing factor 2
• UniProt Protein Name: Apoptosis-inducing factor 2
• Protein Family: Apoptosis-inducing factor
• UniProt Gene Name: Aifm2
• UniProt Synonym Gene Names: Amid

Uniprot Description

Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death (). May contribute to genotoxin-induced growth arrest.