Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Apoptosis-inducing factor 2 (Aifm2) Recombinant Protein | Aifm2 recombinant protein

Recombinant Mouse Apoptosis-inducing factor 2 (Aifm2), partial

Gene Names
Aifm2; Amid; PRG3; 5430437E11Rik; D730001I10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis-inducing factor 2 (Aifm2); Recombinant Mouse Apoptosis-inducing factor 2 (Aifm2); partial; Aifm2 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-373. Partial
Sequence
SQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Aifm2 recombinant protein
This protein has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8
AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,356 Da
NCBI Official Full Name
apoptosis-inducing factor 2 isoform 2
NCBI Official Synonym Full Names
apoptosis-inducing factor, mitochondrion-associated 2
NCBI Official Symbol
Aifm2
NCBI Official Synonym Symbols
Amid; PRG3; 5430437E11Rik; D730001I10Rik
NCBI Protein Information
apoptosis-inducing factor 2
UniProt Protein Name
Apoptosis-inducing factor 2
Protein Family
UniProt Gene Name
Aifm2
UniProt Synonym Gene Names
Amid

Uniprot Description

Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death (). May contribute to genotoxin-induced growth arrest.

Research Articles on Aifm2

Similar Products

Product Notes

The Aifm2 aifm2 (Catalog #AAA1344778) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-373. Partial. The amino acid sequence is listed below: SQLQALNVPF MLVDMKDSFH HNVAALRASV ESGFAKKTFI SYSATFKDNF RQGKVIGIDL KNRMVLLQGG EALPFSHLIL ATGSTGPFPG KFNEVSCQQA AIQAYEDMVK QIQRSQFIVV VGGGSAGVEM AAEIKTEYPE KEVTLIHSRV PLADKELLPC VRQEVKEILL RKGVQLLLSE RVSNLEELPR NEYREYIKVE TDKGTEVATN MVIVCNGIKI NSSAYRSAFE SRLASNGALK VNEFLQVEGY SNIYAIGDCA DTKEPKMAYH AGLHANVAVA NIVNSMKQRP LKAYKPGALT FLLSMGRNDG VGQISGFYVG RLMVRLAKSR DLLISTSWKT MRQSPP . It is sometimes possible for the material contained within the vial of "Apoptosis-inducing factor 2 (Aifm2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual