E3 ubiquitin-protein ligase CIP8 (CIP8) Recombinant Protein | CIP8 recombinant protein
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase CIP8 (CIP8)
Gene Names
CIP8; COP1-interacting protein 8; COP1-INTERACTING PROTEIN CIP8; MXK3.15; MXK3_15
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase CIP8 (CIP8); Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase CIP8 (CIP8); CIP8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-334, Full length protein
Sequence
MSDAPSSSPDATASHWCYHCNKRVVVETLDDFVVCCECNKGFVESIQPTPAAYSSPAPPQPLSPDLNVEDSSIGSHFLQMLRLLAHAPSQRSPPRHLDVLSYEDDFFRLELNSRNEIDDDEDEDEDDGDEEEEDEEENLTVNDEEDEEDDLRRRNRFPLTTTQSRTGRNRILDWAEILMGIEDNSIEFRMESDRYAGNPADYIDDAAGYEALLQNLAEGDGGGGGGRRGAPPAAKSAIEALETFEVSSSEGEMVMVCAVCKDGMVMGETGKKLPCGHCYHGDCIVPWLGTRNSCPVCRFQLETDDAEYEEERKKRTSTVSDSAAASSSSSTSRY
Sequence Length
334
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,965 Da
NCBI Official Full Name
COP1-interacting protein 8
NCBI Official Symbol
CIP8
NCBI Official Synonym Symbols
COP1-interacting protein 8; COP1-INTERACTING PROTEIN CIP8; MXK3.15; MXK3_15
NCBI Protein Information
COP1-interacting protein 8
UniProt Protein Name
E3 ubiquitin-protein ligase CIP8
Protein Family
UniProt Gene Name
CIP8
NCBI Description
Encodes a RING-H2 protein that interacts with the RING finger domain of COP1. CIP8 exhibits a strong interaction with the E2 ubiquitin conjugating enzyme AtUBC8 through its N-terminal domain and promotes ubiquitination in an E2-dependent fashion in vitro. It is possible that the AtUBC8-CIP8 module might interact with COP1 in vivo, thereby participating in proteasome-mediated degradation of HY5.
Uniprot Description
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. Probably forms a minimal ubiquitin ligase complex in cooperation with the E2 enzyme UBC8. Its interaction with COP1 suggests that it may participate in proteasome-mediated degradation of HY5 in vivo.
Similar Products
Product Notes
The CIP8 cip8 (Catalog #AAA1343941) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-334, Full length protein. The amino acid sequence is listed below: MSDAPSSSPD ATASHWCYHC NKRVVVETLD DFVVCCECNK GFVESIQPTP AAYSSPAPPQ PLSPDLNVED SSIGSHFLQM LRLLAHAPSQ RSPPRHLDVL SYEDDFFRLE LNSRNEIDDD EDEDEDDGDE EEEDEEENLT VNDEEDEEDD LRRRNRFPLT TTQSRTGRNR ILDWAEILMG IEDNSIEFRM ESDRYAGNPA DYIDDAAGYE ALLQNLAEGD GGGGGGRRGA PPAAKSAIEA LETFEVSSSE GEMVMVCAVC KDGMVMGETG KKLPCGHCYH GDCIVPWLGT RNSCPVCRFQ LETDDAEYEE ERKKRTSTVS DSAAASSSSS TSRY. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase CIP8 (CIP8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
