PRKC apoptosis WT1 regulator protein (Pawr) Recombinant Protein | Pawr recombinant protein
Recombinant Mouse PRKC apoptosis WT1 regulator protein (Pawr)
Gene Names
Pawr; PAR4; Par-4; 2310001G03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PRKC apoptosis WT1 regulator protein (Pawr); Recombinant Mouse PRKC apoptosis WT1 regulator protein (Pawr); Pawr recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-333, full length protein
Sequence
MATGGYRSGGSTTTDFLEEWKAKREKMRAKQNPAGPGSSGGDPAAKSPAGSLTPTAVAGTSELNHGPAGAAAPAAPAPGALNCAHGSSTLPRAAPGSRRAEDECPSAAAASGAPGSRGDEEEPDSAREKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAATLPDPGTSYLPQDPSRTVPGRYKSTTSAPEDEISNRYPRTDRSGFSRHNRDANAPASFSSSSTLEKRIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR
Sequence Length
333
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pawr recombinant protein
The tumor suppressor WT1 represses and activates transcription. This protein is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,944 Da
NCBI Official Full Name
PRKC apoptosis WT1 regulator protein
NCBI Official Synonym Full Names
PRKC, apoptosis, WT1, regulator
NCBI Official Symbol
Pawr
NCBI Official Synonym Symbols
PAR4; Par-4; 2310001G03Rik
NCBI Protein Information
PRKC apoptosis WT1 regulator protein
UniProt Protein Name
PRKC apoptosis WT1 regulator protein
Protein Family
UniProt Gene Name
Pawr
UniProt Synonym Gene Names
Par4; Par-4
Uniprot Description
Pro-apoptopic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1 ().
Research Articles on Pawr
1. Findings reveal a novel role for Par-4/NF-kappaB in islet beta cell apoptosis and type 2 diabetes.
Similar Products
Product Notes
The Pawr pawr (Catalog #AAA1336886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-333, full length protein. The amino acid sequence is listed below: MATGGYRSGG STTTDFLEEW KAKREKMRAK QNPAGPGSSG GDPAAKSPAG SLTPTAVAGT SELNHGPAGA AAPAAPAPGA LNCAHGSSTL PRAAPGSRRA EDECPSAAAA SGAPGSRGDE EEPDSAREKG RSSGPSARKG KGQIEKRKLR EKRRSTGVVN IPAAECLDEY EDDEAGQKER KREDAITQQN TIQNEAATLP DPGTSYLPQD PSRTVPGRYK STTSAPEDEI SNRYPRTDRS GFSRHNRDAN APASFSSSST LEKRIEDLEK EVVRERQENL RLVRLMQDKE EMIGKLKEEI DLLNRDLDDM EDENEQLKQE NKTLLKVVGQ LTR. It is sometimes possible for the material contained within the vial of "PRKC apoptosis WT1 regulator protein (Pawr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
