Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein lin-28 homolog A (lin28a) Recombinant Protein | lin28a recombinant protein

Recombinant Danio rerio Protein lin-28 homolog A (lin28a)

Gene Names
lin28a; lin28; sb:cb650; zgc:55584
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein lin-28 homolog A (lin28a); Recombinant Danio rerio Protein lin-28 homolog A (lin28a); lin28a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-202, Full length protein
Sequence
MPPANPHLNHTGGCTKTEEEEAASSEEDSGSFHGSGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDRCFNCGGPNHHAKECQLPPQPKKCHFCQSISHMVANCPIKAQQLSPGSQGKSTTSTGEEEDMSHTPLLPESTD
Sequence Length
202
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,886 Da
NCBI Official Full Name
protein lin-28 homolog A
NCBI Official Synonym Full Names
lin-28 homolog A (C. elegans)
NCBI Official Symbol
lin28a
NCBI Official Synonym Symbols
lin28; sb:cb650; zgc:55584
NCBI Protein Information
protein lin-28 homolog A
UniProt Protein Name
Protein lin-28 homolog A
Protein Family
UniProt Gene Name
lin28a
UniProt Synonym Gene Names
lin28; Lin-28A

Uniprot Description

RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Suppressor of microRNA (miRNA) biogenesis, including that of let-7. Binds specific target miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in their terminal loop, and recruits uridylyltransferase. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation (). Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue ().

Research Articles on lin28a

Similar Products

Product Notes

The lin28a lin28a (Catalog #AAA1335004) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-202, Full length protein. The amino acid sequence is listed below: MPPANPHLNH TGGCTKTEEE EAASSEEDSG SFHGSGVCKW FNVRMGFGFL SMTHREGICL DSPVDVFVHQ SKLHMEGFRS LKEGEAVEFT FKRSSKGLES LQVTGPGGAP CVGSEKKPKG TQKRRSKGDR CFNCGGPNHH AKECQLPPQP KKCHFCQSIS HMVANCPIKA QQLSPGSQGK STTSTGEEED MSHTPLLPES TD. It is sometimes possible for the material contained within the vial of "Protein lin-28 homolog A (lin28a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.