Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2) Recombinant Protein | EIF2S2 recombinant protein

Recombinant Bovine Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2); Recombinant Bovine Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2); EIF2S2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-333, full length protein
Sequence
SGDEMIFDPTMSKKKKKKKKPFMLDEEGDAQTEETQPSETKEVEPEPTEDKDVEADEEDSRKKDASDDLDDLNFFNQKKKKKKSKKIFDIDEAEEGIKDLKIESDVQEPAEPEEDLDIMLGNKKKKKKVVKFPDEDEVLEKDEALEDEDSKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGRRAQLRAKAN
Sequence Length
332
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EIF2S2 recombinant protein
Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with This protein representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,286 Da
NCBI Official Full Name
eukaryotic translation initiation factor 2 subunit 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2 subunit beta
NCBI Official Symbol
EIF2S2
NCBI Protein Information
eukaryotic translation initiation factor 2 subunit 2
UniProt Protein Name
Eukaryotic translation initiation factor 2 subunit 2
UniProt Gene Name
EIF2S2
UniProt Synonym Gene Names
eIF-2-beta

Uniprot Description

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B ().

Similar Products

Product Notes

The EIF2S2 eif2s2 (Catalog #AAA1332271) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-333, full length protein. The amino acid sequence is listed below: SGDEMIFDPT MSKKKKKKKK PFMLDEEGDA QTEETQPSET KEVEPEPTED KDVEADEEDS RKKDASDDLD DLNFFNQKKK KKKSKKIFDI DEAEEGIKDL KIESDVQEPA EPEEDLDIML GNKKKKKKVV KFPDEDEVLE KDEALEDEDS KKDDGISFSN QTGPAWAGSE RDYTYEELLN RVFNIMREKN PDMVAGEKRK FVMKPPQVVR VGTKKTSFVN FTDICKLLHR QPKHLLAFLL AELGTSGSID GNNQLVIKGR FQQKQIENVL RRYIKEYVTC HTCRSPDTIL QKDTRLYFLQ CETCHSRCSV ASIKTGFQAV TGRRAQLRAK AN. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.