Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd) Recombinant Protein | Tradd recombinant protein
Recombinant Mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd)
Gene Names
Tradd; AA930854; 9130005N23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd); Recombinant Mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd); Tradd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-310, full length protein
Sequence
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA
Sequence Length
310
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tradd recombinant protein
This protein is a death domain containing adaptor molecule that interacts with TNFRSF1A
TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6
FAS and adaptor protein FADD
MORT1, and is involved in the Fas-induced cell death pathway.
TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6
FAS and adaptor protein FADD
MORT1, and is involved in the Fas-induced cell death pathway.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,577 Da
NCBI Official Full Name
tumor necrosis factor receptor type 1-associated DEATH domain protein
NCBI Official Synonym Full Names
TNFRSF1A-associated via death domain
NCBI Official Symbol
Tradd
NCBI Official Synonym Symbols
AA930854; 9130005N23Rik
NCBI Protein Information
tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Protein Name
Tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Gene Name
Tradd
UniProt Synonym Gene Names
TNFR1-associated DEATH domain protein
Uniprot Description
Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B (). The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A.
Research Articles on Tradd
Similar Products
Product Notes
The Tradd tradd (Catalog #AAA1331606) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-310, full length protein. The amino acid sequence is listed below: MAAGQNGHEE WVGSAYLFLE SAVDKVILSE AYTDPKKKVA IYKALQTALS ESGDSSDVLQ ILKIHCSDPQ LIVQLRFCGR VLCGRFLQAY REGALRTALQ RCMAPALAQE ALRLQLELRA GAEQLDSWLT DEERCLNYIL AQKPDRLRDE ELAELEDELC KLTCDCTGQG GAIQVASAGS KFPVSSPTEE KPLPAACQTF LFHGQLVVNR PLTLQDQQTF ARSVGLKWRR VGRSLQRNCR ALRDPALDSL AYEYERDGLY EQAFQLLRRF MQAEGRRATL QRLVEALEEN ELTSLAEDLL GQAEPDGGLA. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
