Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fatty acid-binding protein, intestinal (FABP2) Recombinant Protein | FABP2 recombinant protein

Recombinant Pig Fatty acid-binding protein, intestinal (FABP2)

Gene Names
FABP2; I-FABP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fatty acid-binding protein; intestinal (FABP2); Recombinant Pig Fatty acid-binding protein; FABP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-132, Full length protein
Sequence
AFDGAWKIDRNENYDKFMEKMGINVVKRKLAAHDNLKLIITQEGNKFTVKESSTFRNIEIVFELGVTFNYSLADGTELTGNWNLEGNKLVGKFQRVDNGKELNTVREIIGDEMVQTYVYEGVEAKRIFKKN
Sequence Length
131
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FABP2 recombinant protein
The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and
or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,217 Da
NCBI Official Full Name
fatty acid-binding protein, intestinal
NCBI Official Symbol
FABP2
NCBI Official Synonym Symbols
I-FABP
NCBI Protein Information
fatty acid-binding protein, intestinal
UniProt Protein Name
Fatty acid-binding protein, intestinal
UniProt Gene Name
FABP2
UniProt Synonym Gene Names
FABPI; I-FABP

Uniprot Description

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor ().

Research Articles on FABP2

Similar Products

Product Notes

The FABP2 fabp2 (Catalog #AAA1326886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-132, Full length protein. The amino acid sequence is listed below: AFDGAWKIDR NENYDKFMEK MGINVVKRKL AAHDNLKLII TQEGNKFTVK ESSTFRNIEI VFELGVTFNY SLADGTELTG NWNLEGNKLV GKFQRVDNGK ELNTVREIIG DEMVQTYVYE GVEAKRIFKK N. It is sometimes possible for the material contained within the vial of "Fatty acid-binding protein, intestinal (FABP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.