Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-15 receptor subunit alpha (IL15RA) Recombinant Protein | IL15RA recombinant protein

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA)

Gene Names
IL15RA; CD215
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-15 receptor subunit alpha (IL15RA); Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA); Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD_antigen=; CD215Cleaved into the following chain:; 1. Soluble interleukin-15 receptor subunit alpha; 2. sIL-15 receptor subunit alpha; 3. sIL-15R-alpha; 4. sIL-1; IL15RA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-205. Partial, provide the complete extracellular domain.
Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Sequence Length
205
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.4 kDa
NCBI Official Full Name
interleukin-15 receptor subunit alpha isoform 3
NCBI Official Synonym Full Names
interleukin 15 receptor, alpha
NCBI Official Symbol
IL15RA
NCBI Official Synonym Symbols
CD215
NCBI Protein Information
interleukin-15 receptor subunit alpha; interleukin 15 receptor alpha isoform EM2; interleukin 15 receptor alpha isoform IC2; interleukin 15 receptor alpha isoform IC3; interleukin 15 receptor alpha isoform IC4; interleukin 15 receptor alpha isoform IC5; interleukin 15 receptor alpha isoform IC6; interleukin 15 receptor alpha isoform IC7; interleukin 15 receptor alpha isoform IC8
UniProt Protein Name
Interleukin-15 receptor subunit alpha
Protein Family
UniProt Gene Name
IL15RA
UniProt Synonym Gene Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
UniProt Entry Name
I15RA_HUMAN

NCBI Description

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.[provided by RefSeq, Apr 2010]

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; nuclear membrane; cytoplasmic vesicle membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity; protein binding

Biological Process: cell proliferation; cytokine and chemokine mediated signaling pathway; signal transduction

Research Articles on IL15RA

Similar Products

Product Notes

The IL15RA il15ra (Catalog #AAA1322943) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-205. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG HSDTT . It is sometimes possible for the material contained within the vial of "Interleukin-15 receptor subunit alpha (IL15RA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.