ADP-ribosyl cyclase 2 (Bst1) Recombinant Protein | Bst1 recombinant protein
Recombinant Rat ADP-ribosyl cyclase 2 (Bst1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP-ribosyl cyclase 2 (Bst1); Recombinant Rat ADP-ribosyl cyclase 2 (Bst1); Bst1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-294, full length protein
Sequence
ARAAGARWSGEGTTPHLQSIFLGRCAEYTTLLSLEPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHAIPRDKSLFWENNHLLVMSYAENTRRLMPLCDVLYGKVGDFLSWCRQENASGLDYQSCPTAEDCENNAVDAYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTKGFFADFEIPYLQKDKITRIEIWVMHEVGGPHVESCGEGSVKILEDRLEALGFQHSCINDYPPVKFLMCVDHSTHPDCAMNSASASMWRES
Sequence Length
267
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Bst1 recombinant protein
Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,131 Da
NCBI Official Full Name
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
NCBI Official Synonym Full Names
bone marrow stromal cell antigen 1
NCBI Official Symbol
Bst1
NCBI Protein Information
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
UniProt Protein Name
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
Protein Family
UniProt Gene Name
Bst1
UniProt Synonym Gene Names
BST-1; cADPr hydrolase 2
NCBI Description
expressed in pancreatic islet cells [RGD, Feb 2006]
Uniprot Description
Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.
Similar Products
Product Notes
The Bst1 bst1 (Catalog #AAA1322528) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-294, full length protein. The amino acid sequence is listed below: ARAAGARWSG EGTTPHLQSI FLGRCAEYTT LLSLEPGNKN CTAIWEAFKV VLDKDPCSVL PSDYDLFINL SRHAIPRDKS LFWENNHLLV MSYAENTRRL MPLCDVLYGK VGDFLSWCRQ ENASGLDYQS CPTAEDCENN AVDAYWKSAS MQYSRDSSGV INVMLNGSEP KGAYPTKGFF ADFEIPYLQK DKITRIEIWV MHEVGGPHVE SCGEGSVKIL EDRLEALGFQ HSCINDYPPV KFLMCVDHST HPDCAMNSAS ASMWRES. It is sometimes possible for the material contained within the vial of "ADP-ribosyl cyclase 2 (Bst1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
