Target of rapamycin complex subunit LST8 (MLST8) Recombinant Protein | MLST8 recombinant protein

Recombinant Bovine Target of rapamycin complex subunit LST8 (MLST8)

Cat. Num. AAA1320890

• Gene Names: MLST8; GBL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Target of rapamycin complex subunit LST8 (MLST8); Recombinant Bovine Target of rapamycin complex subunit LST8 (MLST8); MLST8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-326, full length protein
• Sequence: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRTMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNVASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
• Sequence Length: 326

• Species: Bovine
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 78365301
• NCBI GeneID: 535236
• NCBI Accession #: NP_001030488.1
• NCBI GenBank Nucleotide #: NM_001035411.1
• UniProt Accession #: Q17QU5; Q58DN5
• Molecular Weight: 35,920 Da
• NCBI Official Full Name: target of rapamycin complex subunit LST8
• NCBI Official Synonym Full Names: MTOR associated protein, LST8 homolog
• NCBI Official Symbol: MLST8
• NCBI Official Synonym Symbols: GBL
• NCBI Protein Information: target of rapamycin complex subunit LST8
• UniProt Protein Name: Target of rapamycin complex subunit LST8
• Protein Family: Target of rapamycin complex
• UniProt Gene Name: MLST8
• UniProt Synonym Gene Names: GBL; LST8; TORC subunit LST8; Protein GbetaL; mLST8

Uniprot Description

Subunit of both mTORC1 and mTORC2, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, LST8 interacts directly with MTOR and enhances its kinase activity. In nutrient-poor conditions, stabilizes the MTOR-RPTOR interaction and favors RPTOR-mediated inhibition of MTOR activity. mTORC2 is also activated by growth factors, but seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657' ().