Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mothers against decapentaplegic homolog 5 (Smad5) Recombinant Protein | Smad5 recombinant protein

Recombinant Rat Mothers against decapentaplegic homolog 5 (Smad5)

Gene Names
Smad5; Madh5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mothers against decapentaplegic homolog 5 (Smad5); Recombinant Rat Mothers against decapentaplegic homolog 5 (Smad5); Smad5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-465, full length protein
Sequence
TSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNSTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPANNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Sequence Length
464
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,215 Da
NCBI Official Full Name
mothers against decapentaplegic homolog 5
NCBI Official Synonym Full Names
SMAD family member 5
NCBI Official Symbol
Smad5
NCBI Official Synonym Symbols
Madh5
NCBI Protein Information
mothers against decapentaplegic homolog 5
UniProt Protein Name
Mothers against decapentaplegic homolog 5
UniProt Gene Name
Smad5
UniProt Synonym Gene Names
Madh5; MAD homolog 5; Mothers against DPP homolog 5; SMAD 5; Smad5

NCBI Description

may play a role in the healing of bone fractures [RGD, Feb 2006]

Uniprot Description

Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD) ().

Research Articles on Smad5

Similar Products

Product Notes

The Smad5 smad5 (Catalog #AAA1320307) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-465, full length protein. The amino acid sequence is listed below: TSMASLFSFT SPAVKRLLGW KQGDEEEKWA EKAVDALVKK LKKKKGAMEE LEKALSSPGQ PSKCVTIPRS LDGRLQVSHR KGLPHVIYCR VWRWPDLQSH HELKPLDICE FPFGSKQKEV CINPYHYKRV ESPVLPPVLV PRHNEFNPQH SLLVQFRNLS HNEPHMPQNA TFPDSFHQPN STPFPLSPNS PYPPSPASST YPNSPASSGP GSPFQLPADT PPPAYMPPDD QMGQDNSQPM DTSNNMIPQI MPSISSRDVQ PVAYEEPKHW CSIVYYELNN RVGEAFHASS TSVLVDGFTD PANNKSRFCL GLLSNVNRNS TIENTRRHIG KGVHLYYVGG EVYAECLSDS SIFVQSRNCN FHHGFHPTTV CKIPSSCSLK IFNNQEFAQL LAQSVNHGFE AVYELTKMCT IRMSFVKGWG AEYHRQDVTS TPCWIEIHLH GPLQWLDKVL TQMGSPLNPI SSVS. It is sometimes possible for the material contained within the vial of "Mothers against decapentaplegic homolog 5 (Smad5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.