Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-glucan water dikinase 1, chloroplastic (GWD1) Recombinant Protein | GWD1 recombinant protein

Recombinant Arabidopsis thaliana Alpha-glucan water dikinase 1, chloroplastic (GWD1) , partial

Gene Names
SEX1; GWD; GWD1; SOP; SOP1; STARCH EXCESS 1; T16B5.10; T16B5_10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-glucan water dikinase 1; chloroplastic (GWD1); Recombinant Arabidopsis thaliana Alpha-glucan water dikinase 1; partial; GWD1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
980-1278aa, partial
Sequence
VRGEEEIPDGAVAVLTPDMPDVLSHVSVRARNGKICFATCFDSGILSDLQGKDGKLLSLQPTSADVVYKEVNDSELSSPSSDNLEDAPPSISLVKKQFAGRYAISSEEFTSDLVGAKSRNIGYLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAVNDKLLVLKKTLDEGDQGALKEIRQTLLGLVAPPELVEELKSTMKSSDMPWPGDEGEQRWEQAWAAIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVGAYPGR
Sequence Length
1,399
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
156,582 Da
NCBI Official Full Name
Pyruvate phosphate dikinase, PEP/pyruvate binding domain-containing protein
NCBI Official Symbol
SEX1
NCBI Official Synonym Symbols
GWD; GWD1; SOP; SOP1; STARCH EXCESS 1; T16B5.10; T16B5_10
NCBI Protein Information
Pyruvate phosphate dikinase, PEP/pyruvate binding domain-containing protein
UniProt Protein Name
Alpha-glucan water dikinase 1, chloroplastic
UniProt Gene Name
GWD1
UniProt Synonym Gene Names
R1; SEX1

NCBI Description

Encodes an alpha-glucan, water dikinase required for starch degradation. Involved in cold-induced freezing tolerance. Mutations that eliminate the GWD protein or affect the dikinase domain of the enzyme dramatically reduce both the amount of phosphate in the amylopectin and the rate of starch degradation. Mature leaves of these mutants accumulate amounts of starch up to seven times greater than those in wild-type leaves. NMR analysis of the mutants, suggests that the gene is specifically involved in the phosphorylation of the glucosyl residues of starch at the C6 position.

Uniprot Description

Mediates the incorporation of phosphate into starch-like alpha-glucan, mostly at the C-6 position of glucose units. Acts as an overall regulator of starch mobilization. Required for starch degradation, suggesting that the phosphate content of starch regulates its degradability.

Research Articles on GWD1

Similar Products

Product Notes

The GWD1 gwd1 (Catalog #AAA1319460) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 980-1278aa, partial. The amino acid sequence is listed below: VRGEEEIPDG AVAVLTPDMP DVLSHVSVRA RNGKICFATC FDSGILSDLQ GKDGKLLSLQ PTSADVVYKE VNDSELSSPS SDNLEDAPPS ISLVKKQFAG RYAISSEEFT SDLVGAKSRN IGYLKGKVPS WVGIPTSVAL PFGVFEKVIS EKANQAVNDK LLVLKKTLDE GDQGALKEIR QTLLGLVAPP ELVEELKSTM KSSDMPWPGD EGEQRWEQAW AAIKKVWASK WNERAYFSTR KVKLDHDYLC MAVLVQEVIN ADYAFVIHTT NPSSGDSSEI YAEVVKGLGE TLVGAYPGR. It is sometimes possible for the material contained within the vial of "Alpha-glucan water dikinase 1, chloroplastic (GWD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.