SH3 domain-binding glutamic acid-rich-like protein 3 (SH3BGRL3) Recombinant Protein | SH3BGRL3 recombinant protein

Recombinant Human SH3 domain-binding glutamic acid-rich-like protein 3 (SH3BGRL3)

Cat. Num. AAA1303853

• Gene Names: SH3BGRL3; TIP-B1; SH3BP-1; HEL-S-297
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: SH3 domain-binding glutamic acid-rich-like protein 3 (SH3BGRL3); Recombinant Human SH3 domain-binding glutamic acid-rich-like protein 3 (SH3BGRL3); SH3BGRL3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-93, Full length protein
• Sequence: SGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
• Sequence Length: 92

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 13775198
• NCBI GeneID: 83442
• NCBI Accession #: NP_112576.1
• NCBI GenBank Nucleotide #: NM_031286.3
• UniProt Accession #: Q9H299; Q5T122
• Molecular Weight: 10,438 Da
• NCBI Official Full Name: SH3 domain-binding glutamic acid-rich-like protein 3
• NCBI Official Synonym Full Names: SH3 domain binding glutamate rich protein like 3
• NCBI Official Symbol: SH3BGRL3
• NCBI Official Synonym Symbols: TIP-B1; SH3BP-1; HEL-S-297
• NCBI Protein Information: SH3 domain-binding glutamic acid-rich-like protein 3
• UniProt Protein Name: SH3 domain-binding glutamic acid-rich-like protein 3
• Protein Family: SH3 domain-binding glutamic acid-rich-like protein
• UniProt Gene Name: SH3BGRL3
• UniProt Synonym Gene Names: SH3BP-1

Uniprot Description

Could act as a modulator of glutaredoxin biological activity.