RNA polymerase II transcription factor SIII subunit A3-like-1 (TCEB3CL) Recombinant Protein | TCEB3CL recombinant protein
Recombinant Human RNA polymerase II transcription factor SIII subunit A3-like-1 (TCEB3CL)
Gene Names
ELOA3B; EloA3C; HsT828; ELOA3L1; TCEB3CL; eloA3-like-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RNA polymerase II transcription factor SIII subunit A3-like-1 (TCEB3CL); Recombinant Human RNA polymerase II transcription factor SIII subunit A3-like-1 (TCEB3CL); TCEB3CL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-546, Full length protein
Sequence
MAAGSTTLRAVGKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLAARWKKLVLVDRNTGPDPQDPEESASRQRFGEALQEREKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQRPHPRSPSREPRAERKRPRMAPADSGPHRDPPTRTAPLPMPEGPEPAVPGEQPGRGHAHAAQGGPLLGQGCQGQPQGEAVGSHSKGHKSSRGASAQKSPPVQESQSERLQAAGADSAGPKTVPSHVFSELWDPSEAWMQANYDLLSAFEAMTSQANPEALSAPTLQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPDALGDVEGVPYSVLEPVLEGWTPDQPYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLRDAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASRRQEKSAGAADPGNGEMEPAPKPAGSSQAPSGLGDGDGGSVSGGGSSNRHAAPADKTRKQAAKKVAPLMAKAIRDYKGRFSRR
Sequence Length
546
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,760 Da
NCBI Official Full Name
RNA polymerase II transcription factor SIII subunit A3-like-1
NCBI Official Synonym Full Names
elongin A3 family member B
NCBI Official Symbol
ELOA3B
NCBI Official Synonym Symbols
EloA3C; HsT828; ELOA3L1; TCEB3CL; eloA3-like-1
NCBI Protein Information
elongin-A3 member B
UniProt Protein Name
Elongin-A3 member B
Protein Family
UniProt Gene Name
ELOA3B
UniProt Synonym Gene Names
EloA3B; EloA3-like-1
Uniprot Description
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
Similar Products
Product Notes
The TCEB3CL eloa3b (Catalog #AAA1300872) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-546, Full length protein. The amino acid sequence is listed below: MAAGSTTLRA VGKLQVRLAT KTEPKKLEKY LQKLSALPMT ADILAETGIR KTVKRLRKHQ HVGDFARDLA ARWKKLVLVD RNTGPDPQDP EESASRQRFG EALQEREKAW GFPENATAPR SPSHSPEHRR TARRTPPGQQ RPHPRSPSRE PRAERKRPRM APADSGPHRD PPTRTAPLPM PEGPEPAVPG EQPGRGHAHA AQGGPLLGQG CQGQPQGEAV GSHSKGHKSS RGASAQKSPP VQESQSERLQ AAGADSAGPK TVPSHVFSEL WDPSEAWMQA NYDLLSAFEA MTSQANPEAL SAPTLQEEAA FPGRRVNAKM PVYSGSRPAC QLQVPTLRQQ CLRVPRNNPD ALGDVEGVPY SVLEPVLEGW TPDQPYRTEK DNAALARETD ELWRIHCLQD FKEEKPQEHE SWRELYLRLR DAREQRLRVV TTKIRSAREN KPSGRQTKMI CFNSVAKTPY DASRRQEKSA GAADPGNGEM EPAPKPAGSS QAPSGLGDGD GGSVSGGGSS NRHAAPADKT RKQAAKKVAP LMAKAIRDYK GRFSRR. It is sometimes possible for the material contained within the vial of "RNA polymerase II transcription factor SIII subunit A3-like-1 (TCEB3CL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
