Thioredoxin-like protein CITRX, chloroplastic (At3g06730) Recombinant Protein | At3g06730 recombinant protein

Recombinant Arabidopsis thaliana Thioredoxin-like protein CITRX, chloroplastic (At3g06730)

Cat. Num. AAA1300484

• Gene Names: TRX z; thioredoxin putative plastidic; Thioredoxin z; TRX P
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Thioredoxin-like protein CITRX; chloroplastic (At3g06730); Recombinant Arabidopsis thaliana Thioredoxin-like protein CITRX; At3g06730 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 82-183, Full length protein
• Sequence: AQELQELVKGDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFISPDPSKDAIRTEGLIPLQMMHDIIDNEM
• Sequence Length: 102

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15230779
• NCBI GeneID: 819858
• NCBI Accession #: NP_187329.1
• NCBI GenBank Nucleotide #: NM_111553.4
• UniProt Accession #: Q9M7X9; Q8LFA3; C0Z2V5
• Molecular Weight: 19,413 Da
• NCBI Official Full Name: Thioredoxin z
• NCBI Official Symbol: TRX z
• NCBI Official Synonym Symbols: thioredoxin putative plastidic; Thioredoxin z; TRX P
• NCBI Protein Information: Thioredoxin z
• UniProt Protein Name: Thioredoxin-like protein CITRX, chloroplastic
• UniProt Gene Name: CITRX
• UniProt Synonym Gene Names: AtCiTrx

NCBI Description

Encodes a plastidial thioredoxin (TRX) isoform that defines a branch of plastidial TRXs lying between x- and y-type TRXs and thus was named TRX z. Possesses disulfide reductase activity in vitro. TRX z was previously named as Trx p (thioredoxin putative and plastidic) before its thioredoxin activity was confirmed (Meng et al., PNAS 2010, 107:3900). Knockout mutant of TRX z has a severe albino phenotype and is inhibited in chloroplast development. Two fructokinase-like proteins (FLN1 and FLN2), members of the pfkB-carbohydrate kinase family, are potential TRX z targets.

Uniprot Description

Thiol-disulfide oxidoreductase that plays a role in proper chloroplast development, most likely through regulating plastid-encoded polymerase (PEP) dependent chloroplast transcription. Acts as a component of the transcriptionally active plastid chromosome that is required for plastid gene expression. May be involved in cell death and defense responses ().