ABC transporter I family member 1 (ABCI1) Recombinant Protein | ABCI1 recombinant protein
Recombinant Arabidopsis thaliana ABC transporter I family member 1 (ABCI1)
Gene Names
ABCI1; ATNAP10; ATP-binding cassette I1; F9N12.11; F9N12_11; NAP10; non-intrinsic ABC protein 10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ABC transporter I family member 1 (ABCI1); Recombinant Arabidopsis thaliana ABC transporter I family member 1 (ABCI1); ABCI1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-229, Full length protein
Sequence
MSIRRPQIPRLLLQNVSCMRNAQQILRHVNVSLHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIFQQYKLQLNWISLKDAIKERFTVLDNVQWFELLENKIGKAQPALELMGLGRLVKEKSRMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDDEGVRLLEYIIAEHRKKGGIVIVATHLPIDIEDAMILRLPPRFPRKMTLIDMLDRADIS
Sequence Length
229
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,976 Da
NCBI Official Full Name
non-intrinsic ABC protein 10
NCBI Official Symbol
ABCI1
NCBI Official Synonym Symbols
ATNAP10; ATP-binding cassette I1; F9N12.11; F9N12_11; NAP10; non-intrinsic ABC protein 10
NCBI Protein Information
non-intrinsic ABC protein 10
UniProt Protein Name
ABC transporter I family member 1
Protein Family
UniProt Gene Name
ABCI1
UniProt Synonym Gene Names
CCMA; NAP10; ABC transporter ABCI.1; AtABCI1
NCBI Description
Encodes a member of a heterogenous group of non-intrinsic ATP-binding cassette (ABC) proteins. Members of this group bear no close resemblance to each other nor to representatives of specific ABC protein subfamilies from other organisms. This grouping is arbitrary and will likely change upon acquisition of further data.
Uniprot Description
Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system ().
Similar Products
Product Notes
The ABCI1 abci1 (Catalog #AAA1297202) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-229, Full length protein. The amino acid sequence is listed below: MSIRRPQIPR LLLQNVSCMR NAQQILRHVN VSLHDGGALV LTGTNGSGKS TFLRMLAGFS KPSAGEILWN GHDITQSGIF QQYKLQLNWI SLKDAIKERF TVLDNVQWFE LLENKIGKAQ PALELMGLGR LVKEKSRMLS MGQRKRLQLA RLLAIDRPIW LLDEPSVALD DEGVRLLEYI IAEHRKKGGI VIVATHLPID IEDAMILRLP PRFPRKMTLI DMLDRADIS. It is sometimes possible for the material contained within the vial of "ABC transporter I family member 1 (ABCI1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
